KEGG   Mus musculus (mouse): 18000Help
Entry
18000             CDS       T01002                                 

Gene name
Sept2, AW208991, Nedd-5, Nedd5, mKIAA0158
Definition
(RefSeq) septin 2
  KO
K16942  
septin 2
Organism
mmu  Mus musculus (mouse)
Pathway
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    18000 (Sept2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     18000 (Sept2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   18000 (Sept2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1; 1 D
AA seq 361 aa AA seqDB search
MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLT
DLYPERIIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIIS
YIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPV
IAKADTLTLKERERLKKRILDEIEEHSIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVV
GSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFR
SERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDSDSGALGQH
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcaacaaccaactcagtttataaatccagaaactcctggctatgttggattt
gcaaatcttcccaatcaagttcaccgaaaatcagtgaagaaggggttcgagttcactctg
atggtggttggtgaatctggtctaggaaaatcaactctcataaacagcttattcctgact
gatctctacccagaaagaattattcctggagctgcagagaaaattgaaagaactgtccag
atagaggcttcgactgttgagattgaagagcggggtgtgaagctgcggcttacagtagtg
gacactcccggctacggggatgccatcaactgcagggattgtttcaagacaattatctcc
tacattgatgagcagtttgaacgctacctacatgatgagagtggactgaacaggcgtcac
atcattgataacagggtacattgttgcttctacttcatttcaccttttggacatggactg
aagcccttagatgttgcatttatgaaagcgatacacaataaggtgaatattgtgcctgtc
attgcgaaagctgacactctcactctgaaggagcgtgagcggcttaagaaaaggattttg
gatgaaattgaagagcatagcattaaaatctatcacttacctgatgcagagtcagatgaa
gatgaagactttaaggagcagactagactcctcaaggccagtatcccattctctgtggtt
ggctccaaccagttgattgaagccaaaggcaagaaggttagaggccgtctctacccatgg
ggtgttgtagaggtggagaacccagaacacaatgactttctgaagctgagaacgatgctc
atcacccacatgcaggacctacaggaagtgacccaagaccttcactatgaaaacttccgt
tctgagaggctgaagagaggcggcaggaaagtagagaatgaggacatgaataaagaccag
atcttgcttgaaaaggaggctgagctccgccgcatgcaagagatgattgcaagaatgcaa
gcgcagatgcagatgcagatgcagggtggtgacagtgacagcggggctctcgggcagcat
gtgtga

DBGET integrated database retrieval system