KEGG   Mus musculus (mouse): 18034Help
Entry
18034             CDS       T01002                                 

Gene name
Nfkb2, NF-kappaB2, lyt, p49, p49/p100, p50B, p52
Definition
(RefSeq) nuclear factor of kappa light polypeptide gene enhancer in B cells 2, p49/p100
  KO
K04469  
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Legionellosis
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    18034 (Nfkb2)
   04064 NF-kappa B signaling pathway
    18034 (Nfkb2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    18034 (Nfkb2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    18034 (Nfkb2)
   05203 Viral carcinogenesis
    18034 (Nfkb2)
   05224 Breast cancer
    18034 (Nfkb2)
  Infectious diseases
   05134 Legionellosis
    18034 (Nfkb2)
   05166 HTLV-I infection
    18034 (Nfkb2)
   05169 Epstein-Barr virus infection
    18034 (Nfkb2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    18034 (Nfkb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19 38.8 cM; 19 C3-D2
AA seq 899 aa AA seqDB search
MDNCYDPGLDGIPEYDDFEFSPSIVEPKDPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVC
AVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSKPQGLTEAERRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGSAGGYGGAGGGGSLGFFSSSLAYNPYQSGAAPMGCYPGGGGGAQMAGSRRDTDAGEGA
EEPRTPPEAPQGEPQALDTLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LMAQDENGDTPLHLAIIHGQTGVIEQIAHVIYHAQYLGVINLTNHLHQTPLHLAVITGQT
RVVSFLLQVGADPTLLDRHGDSALHLALRAGAAAPELLQALLRSGAHAVPQILHMPDFEG
LYPVHLAVHARSPECLDLLVDCGAEVEAPERQGGRTALHLATEMEELGLVTHLVTKLHAN
VNARTFAGNTPLHLAAGLGSPTLTRLLLKAGADIHAENEEPLCPLPSPSTSGSDSDSEGP
ERDTQRNFRGHTPLDLTCSTKVKTLLLNAAQNTTEPPLAPPSPAGPGLSLGDAALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRKTPSPSGSLLRSYKLAGGDLVGLLEALSDMGL
HEGVRLLKGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLCPPPEPPGGLCHGHPQPQVH
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggacaattgctacgatccaggcctggatggcatccccgaatatgatgattttgaattc
agcccctccatcgtggagcctaaggatccagcccctgagacagctgatggcccctatctg
gtgattgtggaacagcccaaacagcgaggcttcagatttcgatatggctgtgaaggcccc
tcccatggaggtttgccaggtgcctccagtgagaagggccggaagacctatcctactgtc
aagatctgtaactatgagggaccggccaagattgaggtggacctggtgacacacagtgac
ccacctcgtgcgcatgcccacagtctggtgggcaagcagtgttcagagttgggagtgtgc
gctgtgtctgtaggacccaaggacatgactgctcaatttaataatctgggtgtcctgcat
gtaaccaagaagaacatgatggagattatgatccagaaacttcagaggcagcgtctccgc
tccaagcctcagggccttacagaggctgagcggcgggagctagagcaggaggccaaggag
ctgaagaaagtcatggatctgagcattgtacggctgcgcttctcagctttccttcgagct
agcgatggctccttctccttgcccctgaagcctgtgatctcccagcccatccatgacagc
aagtctccaggggcctcgaacctgaagatctcccgaatggacaagacagcgggttccgtg
cgcggtggagacgaagtttatttgctctgtgataaggtgcaaaaagacgacattgaggtt
cggttctatgaggatgatgagaatggatggcaagcctttggggacttctctcccacagac
gttcataaacagtatgccattgtgttccggacaccgccctatcacaagatgaagatcgag
aggcctgtaacggtgttcctgcagctgaaacgcaagcgtgggggcgatgtctcggactcc
aaacagttcacatattaccctctggtggaagacaaggaggaagtgcagaggaagcggaga
aaggccttgcccaccttctcccagcccttcgggggcggatcccacatgggtggaggttct
gggggctccgctgggggttatggaggcgctggaggaggtggcagcctcggctttttctcc
tcctccttggcctacaacccctaccaatccggtgcagccccaatgggctgctatccgggt
gggggaggtggagcgcagatggccggttctagacgggacaccgatgctggcgagggggca
gaggagcccaggacgcccccggaggctccccagggcgaaccacaggcccttgacacactg
cagcgagctcgcgagtacaacgcgcgcctgttcggtctggcgcagcgcagcgcccgagcg
ttgctggactacggcgtcaccgcagacgcgcgtgctctgctagcgggacagcgccacctg
ctgatggcacaggacgagaacggagacacgccactgcacctggccatcatccatgggcag
actggtgtcattgagcagatagcccacgtcatttatcacgctcagtacctcggcgtcatc
aacctcaccaaccacctgcaccagacgcctctgcacctggcggtaatcactgggcagaca
agggtggtgagcttcctgctgcaggtgggtgcagaccccacgctgctggatcggcacgga
gactccgccctccacttggctctccgggcaggtgctgcagccccagagctgttgcaggca
ctgttgcgcagcggagcccatgctgtgccccaaatattgcacatgcctgattttgaggga
ctataccctgtacacctggcagtccatgcccgaagccctgagtgcctggatctgttagtt
gactgtggagctgaagtggaggccccagagaggcaagggggccgaactgccctgcatcta
gccacagagatggaggagttggggctggtcacccatctagtcaccaagctccatgctaat
gtgaatgcccggacctttgctggaaacacacccctccacctggcagctggactcgggtcc
ccaactcttactcgcctccttctaaaggctggtgctgacatccatgcagagaatgaggag
cctctgtgcccgctgccctcaccctcgacctctgggagcgactccgactctgaagggcct
gagagggatacccaaagaaacttccgaggccatacccctcttgacctcacttgcagtacc
aaggtgaagactctgctgctaaatgctgctcagaacaccacggagccacccctggcccca
cccagccctgcagggccagggctgtccctgggggatgcagccctgcagaacctggagcaa
ctgctggatggtcccgaagcccagggcagctgggcagagctggcagagcgactggggttg
agaagcctggtggacacatacaggaagaccccgtctcccagcggcagtctccttcgtagt
tacaagctggctggtggggacttggtgggtctattggaggccttgtctgacatgggtctc
catgagggagtcaggctgctgaaaggtcctgagacccgcgacaagctgcccagcacagag
gtgaaagaagacagtgcctatgggagccagtcagtggagcaggaggcagagaagctgtgt
ccaccccctgagcctccaggagggctctgccacgggcacccccagcctcaggtgcactga

DBGET integrated database retrieval system