KEGG   Mus musculus (mouse): 18082Help
Entry
18082             CDS       T01002                                 

Gene name
Nipsnap1
Definition
(RefSeq) nipsnap homolog 1 (C. elegans)
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 A1
AA seq 284 aa AA seqDB search
MAPRLCIISAAARRLFTKPRPRAGDLAAAGAVRFYSKDSEGSWFRSLFVHKVDPRKDAHS
TLLSKKETSNLYKIQFHNVKPECLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQD
QAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRKERSKMLLSRRNQLLLEFSFWNEPQPRA
GPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDL
QSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcggttgtgcatcatctctgcagcggcacggcggctattcacgaagccgaga
ccccgtgctggggacctcgcggctgcgggtgctgtgcgcttctattccaaggacagtgaa
ggaagctggttccgttccctctttgtccacaaggtggatcctcggaaggacgcccactcc
actctgctgtccaagaaggagactagtaatctctacaagatccagtttcacaacgtgaag
cccgaatgtctggatgcctacaacagtctgacggaggctgtactgcccaagctgcacctg
gatgaggactatccctgctcgcttgtgggcaactggaacacgtggtacggggagcaggac
caggcagtacacctatggcggttctcaggtggctacccggccctcatggactgcatgaac
aagctaaaaaacaacaaggagtacctggagttccggaaggaacggagcaagatgctgctg
tccaggagaaaccagttgcttctggagttcagcttctggaatgagccacagccccgagct
ggccccaatatctatgagctgaggacatataaactcaagccaggaaccatgattgaatgg
ggaaacaactgggctcgggccatcaagtaccgtcaggagaaccaggaggcggtgggaggc
ttcttttcacaaataggagagctctacgtggtacaccacttatgggcctacaaagatttg
caatctcgggaggagactcgaaatgcggcctggagaaagaggggctgggatgaaaatgtc
tactacacagtccccttggttcgacacatggagtcacgaatcatgattcctctgaagatt
tctcctctccagtga

DBGET integrated database retrieval system