KEGG   Mus musculus (mouse): 18099Help
Entry
18099             CDS       T01002                                 

Gene name
Nlk, AI194375
Definition
nemo like kinase (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    18099 (Nlk)
   04310 Wnt signaling pathway
    18099 (Nlk)
   04068 FoxO signaling pathway
    18099 (Nlk)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    18099 (Nlk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     18099 (Nlk)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   18099 (Nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B5; 11
AA seq 527 aa AA seqDB search
MSLCGTRANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagctgcagcaggtcaccaccaccaccatcatcaccaccttccacaccttcctcct
cctcaccttcaccaccaccaccaccctcaacaccaccttcatccggggtcggctgctgcc
gtacacccagtccagcagcatacgtcttcggcagctgcggcagccgccgcagcagctgca
gccgcagccatgttaaaccctgggcaacaacagccatatttcccatccccggcaccgggt
caggctcctgggccagccgcagcagccccagctcaggtacaggctgctgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccgcaacagcagctggacattgagccg
gatagaccaattggatatggagcctttggcgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcactcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agagtcttccgggaattgaagatgttgtgtttttttaaacatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgatctacataaaattatcgtctctcctcagccactcagctcggatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttgcatcgagacattaagccagggaacctccttgtgaacagcaattgtgttctaaagatt
tgtgattttggattggccagagtggaggaattggatgaatcccgtcatatgactcaggaa
gtagttactcagtattaccgggctccggagatcctgatgggcagccgtcattacagcaat
gctatcgacatctggtctgtcgggtgcatctttgcagagctactgggccgaagaatattg
tttcaggcgcagagtcccattcagcagttggatttgatcacagatctgttgggcacacca
tcactggaagcaatgaggacagcttgtgaaggtgctaaggcacacatactcaggggtcct
cataaacagccatctcttcctgtgctctacaccctctccagccaggccacacatgaagct
gttcacctgctttgcaggatgttggtctttgatccatcaaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcggctgagataccatacgtgtatgtgcaag
tgctgcttttccacctcaacggggagagtctacaccagtgactttgagcctgtcaccaac
cccaaatttgatgacacctttgagaagaacctcagctctgtccgacaggttaaagaaatt
atccaccagttcattctggaacagcagaaaggaaacagagtgcctctctgcatcaacccg
cagtccgctgcctttaagagctttattagttccaccgtcgctcagccgtctgagatgccg
ccgtctcctctggtgtgggagtga

DBGET integrated database retrieval system