KEGG   Mus musculus (mouse): 18113Help
Entry
18113             CDS       T01002                                 

Gene name
Nnmt
Definition
(RefSeq) nicotinamide N-methyltransferase
  KO
K00541  nicotinamide N-methyltransferase [EC:2.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    18113 (Nnmt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.1  nicotinamide N-methyltransferase
     18113 (Nnmt)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   Other histone modification proteins
    18113 (Nnmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NNMT_PNMT_TEMT Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 18113
NCBI-ProteinID: NP_035054
MGI: 1099443
Ensembl: ENSMUSG00000032271
Vega: OTTMUSG00000027445
UniProt: O55239 Q9D9X3
Structure
PDB: 

Jmol
Position
9 A5.3; 9 26.45 cM
AA seq 264 aa AA seqDB search
MESGFTSKDTYLSHFNPRDYLEKYYSFGSRHCAENEILRHLLKNLFKIFCLGAVKGELLI
DIGSGPTIYQLLSACESFTEIIVSDYTDQNLWELQKWLKKEPGAFDWSPVVTYVCDLEGN
RMKGPEKEEKLRRAIKQVLKCDVTQSQPLGGVSLPPADCLLSTLCLDAACPDLPAYRTAL
RNLGSLLKPGGFLVMVDALKSSYYMIGEQKFSSLPLGWETVRDAVEEAGYTIEQFEVISQ
NYSSTTSNNEGLFSLVGRKPGRSE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaatctggcttcacctccaaggacacttatctaagtcattttaatcctcgggattac
ttggaaaaatattacagctttgggtccagacactgtgcagaaaacgagatcctcagacat
ctgctgaaaaatctttttaagatattctgcctgggtgctgtaaaaggagaactcctgatt
gacattggctctggccccaccatctatcagcttctctctgcctgtgagtccttcacggag
atcattgtctctgactacacagaccagaacctctgggagctgcagaaatggctgaagaag
gaaccaggagcctttgactggtccccagtggtcacctatgtgtgtgatcttgaaggcaac
agaatgaagggacctgagaaggaggagaagttgaggcgtgcaatcaagcaggtactaaag
tgtgatgtgacccagagccagcctctgggtggggtctctctgcctcctgctgactgcttg
ctcagcacgctgtgcctggatgctgcctgccctgacctcccggcctatcgcactgccctc
aggaacctgggcagtctgctcaagccaggaggcttcctggtgatggtagatgccctgaag
agtagctactacatgattggggagcagaagttttccagccttcccctgggatgggagact
gttcgagatgctgtggaagaggccggttacaccattgagcagtttgaggtgatttctcaa
aattactcttctaccacatccaataatgaaggactcttctccctagtggggcgaaagcca
ggcagatctgaatga

DBGET integrated database retrieval system