KEGG   Mus musculus (mouse): 18140Help
Entry
18140             CDS       T01002                                 

Gene name
Uhrf1, AL022808, ICBP90, Np95, RNF106
Definition
(RefSeq) ubiquitin-like, containing PHD and RING finger domains, 1 (EC:6.3.2.19)
  KO
K10638  
E3 ubiquitin-protein ligase UHRF1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     18140 (Uhrf1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    18140 (Uhrf1)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   Other histone modification proteins
    18140 (Uhrf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17; 17 D-E1
AA seq 782 aa AA seqDB search
MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQMEDGHTLFD
YDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDK
TVWEDTDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMY
HVKYDDYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEIC
RKRQTRTARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQPPPALRNT
GKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECDMAFHLYCLKPPLTSVPPE
PEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGKGMACVGRTTECTIVPA
NHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNY
FTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVV
RNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKD
RTRQLGLTMQYPEGYLEALANKEKSRKRPAKALEQGPSSSKTGKSKQKSTGPTLSSPRAS
KKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGPYQIFLSKVKEAFQCICCQELV
FRPVTTVCQHNVCKDCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGS
GR
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgtggatccaggttcgaactatggatgggaaggagacccacaccgtgaactctctgtcc
aggttgaccaaggtgcaggagctgaggaaaaagattgaggaagtgtttcacgtggaaccc
caactacagagactcttttataggggcaaacagatggaggatggccacacactcttcgat
tatgatgtgcgcctcaatgacacaatccagctgctcgtgcgccagagtctggcactgcct
ctcagtacaaaagaacgggactcggagctctcagactctgactctggctatggtgtgggt
cacagtgaatcagacaagtcgtccacgcatggtgaaggggcagctgaagcggatgacaag
actgtgtgggaggacacggacctggggctgtacaaggtcaatgagtatgtggacgtgcgt
gacaatatcttcggtgcatggtttgaggcccaggtggtccaggtacagaagagagcccta
tctgaggacgagccctgtagctccagtgccgttaagacctcggaggatgacatcatgtac
catgtcaagtatgatgactatccagagcatggagtggacattgtcaaagccaagaatgtc
cgtgctcgtgctcgcactgtgataccatgggagaacctggaggtgggtcaggtggtcatg
gccaactataacgtggactaccccaggaaacgcggcttctggtatgatgttgagatctgt
aggaagcgccaaaccaggacggcacgtgagctatacggcaacatcaggctcttgaatgac
tctcagctcaacaactgtcggatcatgtttgtggatgaagtcttgatgattgagctccct
aaagagaggaggcctttgatcgctagcccctcgcaaccccctcctgccctccggaacaca
gggaagagcggcccatcctgccggttctgcaaggatgatgaaaacaaaccatgtcgaaag
tgtgcctgccatgtgtgtggtgggcgcgaggctcctgagaaacagctgttgtgtgatgag
tgtgacatggccttccacctgtactgcctgaagccaccgctcacctctgtcccccctgag
ccggagtggtactgccccagctgccgcactgactcaagtgaggtggtacaagcaggggag
aagctgaaggagagcaagaagaaggcaaagatggcatcagccacttcctcctcccggcgg
gactggggcaagggcatggcatgtgtgggccgcaccacagagtgtaccattgtgcccgcc
aaccacttcgggcccatccctggtgtccctgtgggcaccatgtggcgcttcagagtccag
gtcagtgagtccggtgtgcatcggcctcatgtggcaggcatccatggccggagcaacgac
ggtgcctactcattggtcctggctggtggctatgaggatgatgtggacaatggcaattac
ttcacatacacagggagtggtggccgagacctctctggcaacaagcgtacagcaggccag
tcctctgaccagaagctcactaataacaatagggctctggcactcaattgccactcccca
atcaatgagaaaggtgcggaggctgaagactggcgccaagggaagccagtgcgtgtggtc
cggaacatgaagggcgggaaacacagcaagtacgctcctgcagagggcaaccgctatgat
ggcatctacaaggtggtgaagtactggccagagagagggaaatctggcttcctcgtgtgg
cgttatctccttcgacgagatgacacagagcctgagccctggacccgggagggcaaggac
cgcactcgacagctggggctcactatgcagtaccctgaaggctacttggaggccttggct
aacaaggagaagagcaggaagcgcccggccaaggccttggagcagggaccctcatcttcc
aagacaggcaaaagcaagcagaagtccacagggccaaccctctccagcccccgtgcctct
aagaagagcaagctggagccgtacacactctcagagcagcaggctaacctcatcaaagag
gacaagggcaacgccaagctgtgggatgatgtgctaacttcacttcaggatgggccgtac
cagatcttcctgagcaaggtgaaagaggctttccagtgcatctgctgccaggagctggtg
ttccggccagtcaccaccgtgtgtcagcacaacgtctgtaaggactgtctggacaggtcc
ttccgggcccaggtgttcagctgcccagcctgtcgctttgagctggaccacagctcccca
acccgggtgaaccagcccttgcagaccattctcaaccagctcttccctggctatggcagc
ggccggtga

DBGET integrated database retrieval system