KEGG   Mus musculus (mouse): 18166Help
Entry
18166             CDS       T01002                                 

Gene name
Npy1r, Npyr, Y1-R
Definition
(RefSeq) neuropeptide Y receptor Y1
  KO
K04204  
neuropeptide Y receptor type 1
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    18166 (Npy1r)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18166 (Npy1r)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    18166 (Npy1r)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide Y [OT]
    18166 (Npy1r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 33.15 cM; 8 B3-C2
AA seq 382 aa AA seqDB search
MNSTLFSKVENHSIHYNASENSPLLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLAL
IIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQC
VSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWVLAVASSLPFVIYQILTD
EPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRR
NNMMDKIRDSKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLL
FLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSK
TSLKQASPVAFKKISMNDNEKV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaactctgttctccaaggttgaaaatcactcaattcactataatgcctcagag
aattctccacttctggcttttgaaaatgatgactgccacctgcccttggctgtgatattc
accttggctctcgcttatggggcggtgattattcttggcgtctctggaaacctggcattg
atcataatcattctgaaacagaaggagatgagaaatgtcaccaacattctgatcgtgaac
ctctccttctcagacttgctcgttgcggtcatgtgtctcccgttcacttttgtatataca
ctgatggaccactgggtcttcggggagaccatgtgcaaactgaatccctttgtacagtgt
gtctccatcacagtatccattttctcgctggttctcatcgctgtggaacggcatcagcta
atcatcaacccaagagggtggagaccaaacaatagacatgcttacataggcattactgtc
atttgggtccttgcagtggcttcttctctgccctttgtgatctatcaaattctgaccgac
gagcccttccaaaatgtgtcacttgcggcgttcaaggacaagtatgtgtgctttgacaaa
ttcccatctgactctcacaggctgtcttacacgactctcctcctggtgctgcagtatttc
ggcccactctgctttatattcatatgctacttcaagatatacattcgcttgaaaaggaga
aacaacatgatggacaagatccgggacagtaagtacaggtccagtgagaccaagcgaatc
aacatcatgctgctctccattgtggtcgccttcgccgtctgctggctgccccttaccatc
ttcaacactgtgttcgactggaaccaccagatcattgccacctgcaaccacaatctgctg
tttctgctctgtcacctcaccgccatgatctccacctgcgtcaaccccatcttttatgga
ttcctgaacaaaaatttccagagagacttgcagttcttcttcaacttttgtgacttccgg
tctcgagacgatgactacgagaccatagccatgtctaccatgcatacggatgtgtccaag
acgtctctgaagcaggctagcccagtcgcatttaaaaaaatcagtatgaatgacaatgaa
aaagtctga

DBGET integrated database retrieval system