KEGG   Mus musculus (mouse): 18171Help
Entry
18171             CDS       T01002                                 

Gene name
Nr1i2, PXR, PXR.1, PXR.2, PXR1, SXR, mPXR
Definition
(RefSeq) nuclear receptor subfamily 1, group I, member 2
  KO
K08540  
pregnane X receptor
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    18171 (Nr1i2)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   18171 (Nr1i2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16; 16 B3
AA seq 431 aa AA seqDB search
MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKG
FFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRA
LIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSGCE
LPEFLQASLLEDPATWSQIMKDRVPMKISLQLRGEDGSIWNYQPPSKSDGKEIIPLLPHL
ADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGR
LAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQAISLFSPDRPGVVQRSVVD
QLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDSHPFATP
LMQELFSSTDG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgaggagagctggagccgagttggccttgtacagtgtgaagaagcagactct
gccttggaagagcccatcaacgtagaggaggaagatggaggtcttcaaatctgccgtgta
tgtggggacaaggccaatggctaccacttcaatgtcatgacgtgtgaaggatgcaagggg
tttttcagaagggccatgaaacgcaatgtccggctgaggtgccccttccgcaagggaacc
tgcgagatcacccggaagacacgacggcagtgccaggcctgccgtttgcgcaagtgcctg
gagagtggcatgaagaaagagatgatcatgtccgatgccgctgtggagcagaggcgggcc
ttgatcaagaggaagaagagggaaaagattgaggctccaccgcctggagggcaggggctg
acggaagaacagcaggcgctgatccaggagctgatggacgctcagatgcaaacctttgac
acaactttctcccacttcaaggatttccggctgcctgcagtgttccacagtggctgtgag
cttccagagtttctgcaggcctcactgttggaagaccctgccacatggagtcaaatcatg
aaagacagggttccaatgaagatctctctgcagctgcgcggagaagacggcagcatctgg
aactaccaacccccttccaagagcgacgggaaagagatcatccctcttctgccacacctg
gccgatgtgtcaacctacatgttcaagggcgtcatcaacttcgccaaagtcatatcctac
tttagggacctgcctattgaggaccagatctccctgctgaagggggccacttttgagatg
tgcatcctgaggttcaacacgatgttcgacacggaaacgggaacctgggagtgcggccgg
ctggcttactgcttcgaagaccctaatggtggcttccagaaacttctgttggatccattg
atgaaattccactgcatgctgaagaagctacagctgcataaggaggagtatgtgctgatg
caggccatctccctcttctccccagatcgtcctggtgtggtccagcgcagcgtggtagac
caactgcaggagaggtttgccctcaccctgaaggcctacattgagtgtagtcggccatat
cctgctcacaggttcctgttcctgaagatcatggccgtcctcactgagctgcgaagcatc
aacgcccagcaaacccagcagttgctgcgcatccaagactcgcacccctttgccacccca
ctcatgcaagagttatttagcagcacagatggctga

DBGET integrated database retrieval system