KEGG   Mus musculus (mouse): 18212Help
Entry
18212             CDS       T01002                                 

Gene name
Ntrk2, GP145-TrkB/GP95-TrkB, Tkrb, trk-B, trkB
Definition
(RefSeq) neurotrophic tyrosine kinase, receptor, type 2
  KO
K04360  
neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
PI3K-Akt signaling pathway
Neurotrophin signaling pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    18212 (Ntrk2)
   04010 MAPK signaling pathway
    18212 (Ntrk2)
   04151 PI3K-Akt signaling pathway
    18212 (Ntrk2)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    18212 (Ntrk2)
 Human Diseases
  Substance dependence
   05034 Alcoholism
    18212 (Ntrk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18212 (Ntrk2)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Trk family [OT]
   18212 (Ntrk2)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class VII (TRK receptor family)
   18212 (Ntrk2)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class VII (TRK receptor family)
   18212 (Ntrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
UniProt: 
Position
13 B1; 13 31.2 cM
AA seq 821 aa AA seqDB search
MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEP
NSVDPENITEILIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAYKAFLKNSNLRHI
NFTRNKLTSLSRRHFRHLDLSDLILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNES
SKNMPLANLQIPNCGLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LMAKNEYGKDERQISAHFMGRPGVDYETNPNYPEVLYEDWTTPTDIGDTTNKSNEIPSTD
VADQSNREHLSVYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKGPASVISNDDDSASPL
HHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLK
RELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIV
KFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIA
AGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMP
PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQE
VYELMLGCWQREPHTRKNIKSIHTLLQNLAKASPVYLDILG
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccctggctgaagtggcatggacccgccatggcgcggctctggggcttatgcctg
ctggtcttgggcttctggagggcctctctcgcctgcccgacgtcctgcaaatgcagttcc
gctaggatttggtgtactgagccttctccaggcatcgtggcattcccgaggttggaacct
aacagcgttgacccggagaacatcacggaaattctcattgcaaaccagaaaaggctagaa
atcatcaatgaagatgacgttgaagcttacgtggggctgagaaaccttacaattgtggat
tccggcttaaagtttgtggcttacaaagcgtttctgaaaaacagcaacctgcggcacata
aatttcacacgaaacaagctgacgagtttgtccaggagacatttccgccaccttgacttg
tctgacctgatcctgacgggtaatccgttcacgtgctcctgcgacatcatgtggctcaag
actctccaggagactaaatccagccccgacactcaggatttgtactgcctcaatgagagc
agcaagaacatgcccctggcgaacctgcagatacccaattgtggtctgccatctgcacgt
ctggctgctcctaacctcaccgtggaggaaggaaagtctgtgaccctttcctgcagtgtg
gggggtgacccactccccaccttgtactgggacgttgggaatttggtttccaagcacatg
aatgaaacaagccacacacagggctccttaaggataacgaacatttcatctgatgacagt
ggaaagcaaatctcttgtgtggcagaaaaccttgtaggagaagatcaagattctgtgaac
ctcactgtgcattttgcgccaactatcacgtttctcgagtctccaacctcagatcaccac
tggtgcattccattcactgtgagaggcaaccccaagcctgcgcttcagtggttctacaat
ggggccatactgaatgagtccaagtacatctgtactaagatccacgtcaccaatcacacg
gagtaccatggctgcctccagctggataaccccactcatatgaataacggagactacacc
ctgatggccaagaacgagtatgggaaggatgagagacagatctccgctcacttcatgggc
cggcctggagtcgactacgagacaaacccaaattaccctgaagtcctctatgaagactgg
accacgccaactgacattggggatactacgaacaaaagtaatgaaatcccctccacggat
gttgctgaccaaagcaatcgggagcatctctcggtctatgccgtggtggtgattgcatct
gtggtgggattctgcctgctggtgatgttgctcctgctcaagttggcgagacattccaag
tttggcatgaaaggcccagcttcggtcatcagcaacgacgatgactctgccagccccctc
caccacatctccaatgggagtaacactccatcttcttcggagggcggtcccgacgctgtc
attattggaatgaccaagattcctgttattgaaaacccccagtactttggcatcaccaac
agtcagctcaagccagacacatttgttcagcatatcaagagacacaacatcgttctgaag
agggaacttggggaaggagccttcgggaaagttttccttgccgagtgctacaacctctgc
ccagagcaggataagatcctggtggctgtgaagacgctgaaggacgccagcgacaatgca
cgcaaggactttcatcgggaagctgagctgctgaccaacctccagcacgagcacattgtc
aagttctacggtgtctgtgtggagggcgacccactcatcatggtctttgagtacatgaag
cacggggacctcaacaagttccttagggcacacgggcccgacgcagtgctgatggcagag
ggtaacccgcccacagagctgacgcagtcgcagatgctgcacatcgctcagcaaatcgca
gcaggtatggtctacctggcgtcccaacactttgtgcaccgtgacctggccacccggaac
tgcctggtgggagagaacctgctggtgaaaattggggactttgggatgtcccgagatgtg
tacagcaccgactactatcgggtcggtggccacacaatgttgcccatccgatggatgcct
ccagagagcatcatgtacaggaaattcaccaccgagagcgacgtctggagcctgggcgtt
gtgttgtgggagatcttcacctacggcaagcagccctggtatcagctatcgaacaatgag
gtgatagagtgcatcacccagggaagagtccttcagcggcctcgaacgtgtccccaggag
gtgtatgagctcatgcttggatgctggcagcgggaaccacacacccggaagaacatcaag
agcatccacaccctccttcagaacttggccaaggcatctcccgtctacctggatatccta
ggctag

DBGET integrated database retrieval system