KEGG   Mus musculus (mouse): 18213Help
Entry
18213             CDS       T01002                                 

Gene name
Ntrk3, AW125844, Ntrk3_tv3, TrkC
Definition
(RefSeq) neurotrophic tyrosine kinase, receptor, type 3
  KO
K05101  
neurotrophic tyrosine kinase, receptor type 3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Neurotrophin signaling pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    18213 (Ntrk3)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    18213 (Ntrk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18213 (Ntrk3)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Trk family [OT]
   18213 (Ntrk3)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class VII (TRK receptor family)
   18213 (Ntrk3)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class VII (TRK receptor family)
   18213 (Ntrk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 D3; 7 44.01 cM
AA seq 825 aa AA seqDB search
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRGLHTLNAVDMELYTGLQKLTIKNSGLRNIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELRLEQNFFNCSCDIRWMQLWQEQGEA
RLDSQSLYCISADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLVEPEVRLEHCIEFVVRGNPTPTLHWLYNGQPLRESKIIHMDYYQEGEVSE
GCLLFNKPTHYNNGNYTLIAKNALGTANQTINGHFLKEPFPESTDFFDFESDASPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRVGGHTMLPI
RWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRV
CPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggatgtctctctttgcccagccaagtgtagtttctggcggattttcttgctgggaagc
gtctggctggactatgtgggctccgtgctggcttgccctgcaaattgtgtctgcagcaag
actgagatcaattgccggcggccggacgatgggaacctcttccctctcctggaagggcag
gattcagggaacagcaatgggaacgccagcatcaacattacggacatctcaaggaatatc
acttccatacacatagagaactggcgaggcctgcacacactcaatgctgtggacatggag
ctctacacgggactccagaagctgaccatcaagaattctggactccggaacatccagccc
agagccttcgccaagaacccccacttgcgttatataaacttgtcaagtaaccggctcacc
acactctcctggcagctcttccagacgctgagccttcgggaattgagactggagcagaac
ttcttcaactgcagctgtgacatccgctggatgcagctgtggcaggaacagggggaggcg
cggctggacagccagagcctttactgcatcagtgctgatggctcccaactccccctcttc
cgcatgaacatcagtcagtgtgatctcccagagatcagtgtgagccacgtcaacctgact
gtccgagaaggagacaatgccgtgatcacttgcaatggctctggctctcctttgcctgat
gtggactggatagtcactgggctgcagtccatcaacacccaccagaccaatctgaactgg
accaatgtacatgccatcaacttgaccctggtgaacgtgacgagcgaggacaatggcttc
accctgacgtgcattgcagagaacgtggtgggcatgagcaatgccagtgttgctctcact
gtctactaccctccacgtgtggtgagcctggtggagcctgaggtacgcctggaacattgc
attgagtttgtggtgcgtggcaacccgacacccacgctccactggctgtacaatggacag
ccattgagggagtccaagatcattcacatggactactaccaggagggggaggtctcagag
ggctgcctgctcttcaacaagcccacccactacaacaatggcaactacaccctcattgct
aagaatgccctgggcacggccaaccagaccatcaacggccacttcctgaaggagcccttt
ccagagagcacagatttctttgactttgagtctgatgcgagccctacacctcctatcact
gtgacccacaaaccagaggaagacacttttggggtgtccatagcagtcggacttgctgcc
tttgcctgcgtccttctggtggttctctttatcatgatcaacaagtatggtcgccggtcc
aaatttggaatgaagggtcctgtggctgttatcagtggagaggaggactcagccagccca
ctgcatcacatcaaccatggcatcactacaccatcatcgttggatgctgggcctgacaca
gtggtcattggcatgacccgcatcccagtcattgagaacccccagtacttccgtcagggt
cacaattgccacaagccagacacatatgttcagcacatcaagaggagagacatcgtgttg
aagagagaattgggtgagggagcctttgggaaggtcttcctggctgagtgctacaatcta
agccccaccaaagacaagatgctagtggcagtgaaggccctgaaggatcccaccttggct
gccaggaaggatttccagagggaggctgagctgctcacgaacctgcagcatgagcatatt
gtcaagttctatggggtgtgtggtgatggtgacccactcatcatggtctttgaatacatg
aagcatggagaccttaacaagttcctcagggcccatgggccagatgccatgatcctcgtg
gatggacagccacgtcaggccaagggggagctagggctctctcagatgctccacatcgcc
agtcagatagcctcgggcatggtgtacctggcttcccagcactttgtacaccgggacctg
gccacgaggaactgcctggttggagccaatctactagtgaagattggagattttggcatg
tccagggacgtctacagtactgattactacagggtgggaggacacaccatgctccccatc
cgctggatgccccctgaaagcataatgtaccggaagttcaccacagagagtgatgtctgg
agcttcggggttattctttgggagatctttacctatgggaagcaaccatggttccagctt
tccaacacggaggtcattgaatgcatcacccaaggccgtgtcttggagagacccagagtc
tgccctaaagaagtgtatgatgtcatgctggggtgctggcagagggaaccacagcagcgg
ctgaatattaaggagatctacaaaatcctccatgctttggggaaggccaccccgatctac
ctggacattcttggctag

DBGET integrated database retrieval system