KEGG   Mus musculus (mouse): 18216Help
Entry
18216             CDS       T01002                                 

Gene name
Ntsr1, NT-1R, NTR-1, NTR1
Definition
(RefSeq) neurotensin receptor 1
  KO
K04211  neurotensin receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    18216 (Ntsr1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18216 (Ntsr1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neurotensin
    18216 (Ntsr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 18216
NCBI-ProteinID: NP_061236
MGI: 97386
Ensembl: ENSMUSG00000027568
Vega: OTTMUSG00000016330
UniProt: O88319 A2ACT4
Position
2 H4; 2 103.04 cM
AA seq 424 aa AA seqDB search
MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLLALSLSNGSGNSSESILEPNSNLDVNTDI
YSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAM
PVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLM
SRSRTKKFISAIWLASALLAVPMLFTMGLQNRSADGQHPGGLVCTPTVDTATVKVVIQVN
TFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVGTHNSLEHSTFNMSIEPGRV
QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV
SSAINPILYNLVSANFRQVFLSTLACLCPGWRRRRKKRPTFSRKPNSMSSNHAFSTSATR
ETLY
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcaacagctccgtgcagcagggagccccaagtgaacccggtgcccagcccttc
ccacatccacagttcggactggagacgatgctcctggcgctcagcttgagcaatggttct
ggcaattcctcagaatccatcctggagcccaacagcaacctggacgtgaacactgacatt
tattccaaggtgctggtgaccgctgtatacctggcactttttgtggtgggcactgtgggc
aactcggtgacagccttcactctagcgcggaagaagtcgctgcagagcctgcagagcact
gtgcattaccacctgggtagcctggcactgtctgacctgctcatcctgctgctggccatg
cccgtggagctgtacaacttcatctgggtgcaccatccctgggcctttggggatgctggc
tgccgtggctactatttcctgcgagatgcctgcacctatgccacagccctcaatgtagcc
agcctgagtgtggagcgctacttggccatctgccatcccttcaaggccaagaccctcatg
tcccgcagccgcaccaagaaattcatcagtgccatatggctagcctcggcgctgctggct
gtacccatgcttttcaccatgggcctgcagaaccgcagtgccgatggccagcaccctggt
ggcctggtgtgcacacccacggtggacacagccaccgtcaaggtcgtcatccaggttaac
accttcatgtccttcctgtttcccatgctgatcatctccatcctaaacactgtgatagcc
aacaaactgaccgtcatggtgcaccaggctgccgagcagggccgtggtgtgtgcaccgtg
ggcacccacaacagtttagagcacagcacgttcaacatgtccatcgagccaggccgtgtc
caggccctgcgccatggagtcctcgtcttacgtgctgtggtaatcgcctttgtggtctgc
tggctgccctaccacgtgcggcgcctcatgttctgctatatctcagatgaacagtggact
acgttcctcttcgacttctaccactatttctatatgctgaccaacgctctcttctacgtc
agctcagccatcaatcccatcctttacaacctcgtctccgccaacttccgccaggtcttc
ctgtccacactggcttgcctctgtcctgggtggcgccgccgccgaaagaagaggccaacg
ttctccaggaagccaaacagcatgtccagcaaccatgcgttttccaccagcgccacccgg
gaaaccctgtactag

DBGET integrated database retrieval system