KEGG   Mus musculus (mouse): 18216Help
Entry
18216             CDS       T01002                                 

Gene name
Ntsr1, NT-1R, NTR-1, NTR1
Definition
(RefSeq) neurotensin receptor 1
  KO
K04211  
neurotensin receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    18216 (Ntsr1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18216 (Ntsr1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neurotensin
    18216 (Ntsr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 103.04 cM; 2 H1-H4
AA seq 424 aa AA seqDB search
MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLLALSLSNGSGNSSESILEPNSNLDVNTDI
YSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAM
PVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLM
SRSRTKKFISAIWLASALLAVPMLFTMGLQNRSADGQHPGGLVCTPTVDTATVKVVIQVN
TFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVGTHNSLEHSTFNMSIEPGRV
QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV
SSAINPILYNLVSANFRQVFLSTLACLCPGWRRRRKKRPTFSRKPNSMSSNHAFSTSATR
ETLY
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcaacagctccgtgcagcagggagccccaagtgaacccggtgcccagcccttc
ccacatccacagttcggactggagacgatgctcctggcgctcagcttgagcaatggttct
ggcaattcctcagaatccatcctggagcccaacagcaacctggacgtgaacactgacatt
tattccaaggtgctggtgaccgctgtatacctggcactttttgtggtgggcactgtgggc
aactcggtgacagccttcactctagcgcggaagaagtcgctgcagagcctgcagagcact
gtgcattaccacctgggtagcctggcactgtctgacctgctcatcctgctgctggccatg
cccgtggagctgtacaacttcatctgggtgcaccatccctgggcctttggggatgctggc
tgccgtggctactatttcctgcgagatgcctgcacctatgccacagccctcaatgtagcc
agcctgagtgtggagcgctacttggccatctgccatcccttcaaggccaagaccctcatg
tcccgcagccgcaccaagaaattcatcagtgccatatggctagcctcggcgctgctggct
gtacccatgcttttcaccatgggcctgcagaaccgcagtgccgatggccagcaccctggt
ggcctggtgtgcacacccacggtggacacagccaccgtcaaggtcgtcatccaggttaac
accttcatgtccttcctgtttcccatgctgatcatctccatcctaaacactgtgatagcc
aacaaactgaccgtcatggtgcaccaggctgccgagcagggccgtggtgtgtgcaccgtg
ggcacccacaacagtttagagcacagcacgttcaacatgtccatcgagccaggccgtgtc
caggccctgcgccatggagtcctcgtcttacgtgctgtggtaatcgcctttgtggtctgc
tggctgccctaccacgtgcggcgcctcatgttctgctatatctcagatgaacagtggact
acgttcctcttcgacttctaccactatttctatatgctgaccaacgctctcttctacgtc
agctcagccatcaatcccatcctttacaacctcgtctccgccaacttccgccaggtcttc
ctgtccacactggcttgcctctgtcctgggtggcgccgccgccgaaagaagaggccaacg
ttctccaggaagccaaacagcatgtccagcaaccatgcgttttccaccagcgccacccgg
gaaaccctgtactag

DBGET integrated database retrieval system