KEGG   Mus musculus (mouse): 18263Help
Entry
18263             CDS       T01002                                 

Gene name
Odc1, ODC
Definition
(RefSeq) ornithine decarboxylase, structural 1 (EC:4.1.1.17)
  KO
K01581  
ornithine decarboxylase [EC:4.1.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    18263 (Odc1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    18263 (Odc1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     18263 (Odc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12 A1.1; 12 8.11 cM
AA seq 461 aa AA seqDB search
MSSFTKDEFDCHILDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQI
KYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPG
SEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQ
PGSDDEDESNEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLMKQI
QSHGFPPEVEEQDDGTLPMSCAQESGMDRHPAACASARINV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctttactaaggacgagtttgactgccacatccttgatgaaggctttactgct
aaggacattctggaccaaaaaatcaatgaagtctcttcctctgacgataaggatgcgttc
tatgttgcggacctcggagacattctaaagaagcatctgaggtggctaaaagctcttccc
cgcgtcactcccttttacgcagtcaagtgtaacgatagcagagccatagtgagcacccta
gctgccattgggacaggatttgactgtgcaagcaagactgaaatacagttggtgcagggg
cttggggtgcctgcagagagggttatctatgcaaatccttgtaaacaagtctctcaaatc
aagtatgctgccagtaacggagtccagatgatgacttttgacagtgaaattgaattgatg
aaagtcgccagagcacatccaaaggcaaagttggttctacggattgccactgatgattcc
aaagctgtctgtcgcctcagtgttaagtttggtgccacactcaaaaccagcaggcttctc
ttggaacgggcaaaagagctaaatattgacgtcattggtgtgagcttccatgtgggcagt
ggatgtactgatcctgagaccttcgttcaggcagtgtcggatgcccgctgtgtgtttgac
atggcaacagaagttggtttcagcatgcatctgcttgatattggtggtggctttcctgga
tctgaagatacaaagcttaaatttgaagagatcaccagtgtaatcaacccagctctggac
aagtacttcccatcagactctggagtgagaatcatagctgagccaggcagatactatgtc
gcatcagctttcacgcttgcagtcaacatcattgccaaaaaaaccgtgtggaaggagcag
cccggctctgacgatgaagatgagtcaaatgaacaaaccttcatgtattatgtgaatgat
ggagtatatggatcatttaactgcattctttatgatcatgcccatgtgaaggccctgctg
cagaagagacccaagccagacgagaagtattactcatccagcatctggggaccaacatgt
gatggccttgatcggatcgtggagcgctgtaacctgcctgaaatgcatgtgggtgattgg
atgctgtttgagaacatgggtgcatacactgttgctgctgcttctactttcaatgggttc
cagaggccaaacatctactatgtaatgtcacggccaatgtggcaactcatgaagcagatc
cagagccatggcttcccgccggaggtggaggagcaggatgatggcacgctgcccatgtct
tgtgcccaggagagcgggatggaccgtcaccctgcagcctgtgcttctgctaggatcaat
gtgtag

DBGET integrated database retrieval system