KEGG   Mus musculus (mouse): 18391Help
Entry
18391             CDS       T01002                                 

Gene name
Sigmar1, Oprs1, Sig1R, sigma1R
Definition
(RefSeq) sigma non-opioid intracellular receptor 1
  KO
K20719  
sigma non-opioid intracellular receptor
Organism
mmu  Mus musculus (mouse)
Brite
Transporters [BR:mmu02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   18391 (Sigmar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 A5
AA seq 223 aa AA seqDB search
MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgggccgcgggacggcggtgggcatggatcaccctgattctgactattatcgca
gtgctgatccaggccgcctggttgtggctgggcactcaaaacttcgtcttctctagagaa
gaaatagcgcagcttgctcgacagtatgcggggctggaccatgagcttgccttctctcgg
ctgatcgtggagctgcggaggctgcacccaggccacgtgctgccggatgaggagctgcag
tgggtatttgtgaacgcgggcggctggatgggcgccatgtgtattctgcacgcctcgctg
tctgagtacgtgctgctcttcggcaccgccctgggctcccatggccattcgggacgatac
tgggctgagatttctgacaccatcatctctggcaccttccaccaatggaaagagggcacc
acgaaaagtgaggtcttctacccaggagagacagttgtacacgggcctggagaagcaacg
gctctggagtggggaccaaacacgtggatggtggagtacggccggggtgttattccgtct
accctgttctttgcactagccgacactttcttcagcacccaggactacctcacactcttc
tatacccttcgggcctatgcccggggcctccggcttgagcttaccacctacctctttggc
caagactcctga

DBGET integrated database retrieval system