KEGG   Mus musculus (mouse): 18391Help
Entry
18391             CDS       T01002                                 

Gene name
Sigmar1, Oprs1, sigma1R
Definition
(RefSeq) sigma non-opioid intracellular receptor 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 A5-B2
AA seq 223 aa AA seqDB search
MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgggccgcgggacggcggtgggcatggatcaccctgattctgactattatcgca
gtgctgatccaggccgcctggttgtggctgggcactcaaaacttcgtcttctctagagaa
gaaatagcgcagcttgctcgacagtatgcggggctggaccatgagcttgccttctctcgg
ctgatcgtggagctgcggaggctgcacccaggccacgtgctgccggatgaggagctgcag
tgggtatttgtgaacgcgggcggctggatgggcgccatgtgtattctgcacgcctcgctg
tctgagtacgtgctgctcttcggcaccgccctgggctcccatggccattcgggacgatac
tgggctgagatttctgacaccatcatctctggcaccttccaccaatggaaagagggcacc
acgaaaagtgaggtcttctacccaggagagacagttgtacacgggcctggagaagcaacg
gctctggagtggggaccaaacacgtggatggtggagtacggccggggtgttattccgtct
accctgttctttgcactagccgacactttcttcagcacccaggactacctcacactcttc
tatacccttcgggcctatgcccggggcctccggcttgagcttaccacctacctctttggc
caagactcctga

DBGET integrated database retrieval system