KEGG   Mus musculus (mouse): 18412Help
Entry
18412             CDS       T01002                                 

Gene name
Sqstm1, A170, OSF-6, Osi, STAP, STONE14, p62
Definition
(RefSeq) sequestosome 1
  KO
K14381  
sequestosome 1
Organism
mmu  Mus musculus (mouse)
Pathway
Mitophagy - animal
Necroptosis
Cellular senescence
Osteoclast differentiation
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    18412 (Sqstm1)
  Cell growth and death
   04217 Necroptosis
    18412 (Sqstm1)
   04218 Cellular senescence
    18412 (Sqstm1)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    18412 (Sqstm1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    18412 (Sqstm1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    18412 (Sqstm1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18412 (Sqstm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11; 11 B1.3
AA seq 442 aa AA seqDB search
MASFTVKAYLLGKEEATREIRRFSFCFSPEPEAEAQAAAGPGPCERLLSRVAVLFPTLRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFS
HSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESASAPPEDPNVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPTTPESSSTGTEDKSNTQPSSCSSEVSKPDG
AGEGPAQSLTEQMKKIALESVGQPEEQMESGNCSGGDDDWTHLSSKEVDPSTGELQSLQM
PESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQ
TKNYDIGAALDTIQYSKHPPPL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttcacggtgaaggcctatcttctgggcaaggaggaggcgacccgcgagatc
cgccgcttcagcttctgcttcagcccggagccggaggcggaagcccaagccgcggccggc
ccggggccctgcgagaggctgctgagccgagtggctgtgctgttccccacgctgaggcct
ggcggcttccaggcgcactaccgcgatgaggatggggacttggttgccttttccagtgat
gaggagctgacaatggctatgtcctatgtgaaagatgacatcttccgcatctacattaaa
gagaagaaggagtgccggcgggaacatcgcccaccatgtgctcaggaggcaccccgaaac
atggtgcaccccaatgtgatctgtgatggttgcaacgggcctgtggtgggaactcgctat
aagtgcagtgtgtgcccagactacgacctgtgcagcgtgtgcgaggggaagggcctgcac
agggaacacagcaagctcatctttcccaacccctttggccacctctctgatagcttctct
catagccgctggcttcggaagctgaaacatggacactttggctggcctggctgggagatg
ggcccaccggggaactggagcccacgtcctcctcgtgcaggggatggccgcccttgccct
acagctgagtcagcttctgctccaccagaagatcccaatgtcaatttcctgaagaatgtg
ggggagagtgtggcagctgccctcagccctctaggcattgaggttgacattgatgtggaa
catggagggaagagaagccgcctgacacccactaccccagaaagttccagcacaggcaca
gaagacaagagtaacactcagccaagcagctgctcttcggaagtcagcaaacctgacggg
gctggggagggccctgctcagtctctgacagagcaaatgaaaaagatagccttggagtcg
gtgggacagccagaggaacagatggagtcgggaaactgctcaggaggagacgatgactgg
acacatttgtcttcaaaagaagtggacccatctacaggtgaactccagtctctacagatg
ccagaatcggaagggccaagctctctagacccctcacaggaaggacccacagggctgaag
gaagctgccctatacccacatctcccaccagaggctgatccccggctgattgagtccctc
tcccagatgctgtccatgggtttctcggatgaaggcggctggctcaccaggctcctacag
accaagaattacgacatcggggctgctctggacacgatccagtattcgaagcaccctcca
ccattgtga

DBGET integrated database retrieval system