KEGG   Mus musculus (mouse): 18412Help
Entry
18412             CDS       T01002                                 

Gene name
Sqstm1, A170, OSF-6, Osi, STAP, STONE14, p62
Definition
(RefSeq) sequestosome 1
  KO
K14381  
sequestosome 1
Organism
mmu  Mus musculus (mouse)
Pathway
Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    18412 (Sqstm1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    18412 (Sqstm1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18412 (Sqstm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11; 11 B1.2
AA seq 442 aa AA seqDB search
MASFTVKAYLLGKEEATREIRRFSFCFSPEPEAEAQAAAGPGPCERLLSRVAVLFPTLRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFS
HSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESASAPPEDPNVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPTTPESSSTGTEDKSNTQPSSCSSEVSKPDG
AGEGPAQSLTEQMKKIALESVGQPEEQMESGNCSGGDDDWTHLSSKEVDPSTGELQSLQM
PESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQ
TKNYDIGAALDTIQYSKHPPPL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttcacggtgaaggcctatcttctgggcaaggaggaggcgacccgcgagatc
cgccgcttcagcttctgcttcagcccggagccggaggcggaagcccaagccgcggccggc
ccggggccctgcgagaggctgctgagccgagtggctgtgctgttccccacgctgaggcct
ggcggcttccaggcgcactaccgcgatgaggatggggacttggttgccttttccagtgat
gaggagctgacaatggctatgtcctatgtgaaagatgacatcttccgcatctacattaaa
gagaagaaggagtgccggcgggaacatcgcccaccatgtgctcaggaggcaccccgaaac
atggtgcaccccaatgtgatctgtgatggttgcaacgggcctgtggtgggaactcgctat
aagtgcagtgtgtgcccagactacgacctgtgcagcgtgtgcgaggggaagggcctgcac
agggaacacagcaagctcatctttcccaacccctttggccacctctctgatagcttctct
catagccgctggcttcggaagctgaaacatggacactttggctggcctggctgggagatg
ggcccaccggggaactggagcccacgtcctcctcgtgcaggggatggccgcccttgccct
acagctgagtcagcttctgctccaccagaagatcccaatgtcaatttcctgaagaatgtg
ggggagagtgtggcagctgccctcagccctctaggcattgaggttgacattgatgtggaa
catggagggaagagaagccgcctgacacccactaccccagaaagttccagcacaggcaca
gaagacaagagtaacactcagccaagcagctgctcttcggaagtcagcaaacctgacggg
gctggggagggccctgctcagtctctgacagagcaaatgaaaaagatagccttggagtcg
gtgggacagccagaggaacagatggagtcgggaaactgctcaggaggagacgatgactgg
acacatttgtcttcaaaagaagtggacccatctacaggtgaactccagtctctacagatg
ccagaatcggaagggccaagctctctagacccctcacaggaaggacccacagggctgaag
gaagctgccctatacccacatctcccaccagaggctgatccccggctgattgagtccctc
tcccagatgctgtccatgggtttctcggatgaaggcggctggctcaccaggctcctacag
accaagaattacgacatcggggctgctctggacacgatccagtattcgaagcaccctcca
ccattgtga

DBGET integrated database retrieval system