KEGG   Mus musculus (mouse): 18442Help
Entry
18442             CDS       T01002                                 

Gene name
P2ry2, P2U1, P2Y2
Definition
(RefSeq) purinergic receptor P2Y, G-protein coupled 2
  KO
K04269  purinergic receptor P2Y, G protein-coupled, 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18442 (P2ry2)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18442 (P2ry2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    18442 (P2ry2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 18442
NCBI-ProteinID: NP_001289275
MGI: 105107
Ensembl: ENSMUSG00000032860
Vega: OTTMUSG00000060008
UniProt: P35383 A0A0R4J289
Position
7; 7 E2
AA seq 373 aa AA seqDB search
MAADLEPWNSTINGTWEGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNVVALYIFLC
RLKTWNASTTYMFHLAVSDSLYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTR
ITCHDTSARELFSHFVAYSSVMLGLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAK
RKSVRTIALVLAVFALCFLPFHLTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTEPTPSPQARRKLGLHRPNRTVRKDLSVSSDDSRRTE
STPAGSETKDIRL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagacctggaaccctggaatagcaccatcaatggcacctgggagggggacgaa
ctgggatacaagtgtcgtttcaacgaggacttcaagtacgtgctgttgcccgtgtcctat
ggcgtggtgtgcgtgctcgggttgtgcctgaacgtcgtggctctctatatcttcctatgc
cgcctcaaaacctggaacgcctccaccacctacatgtttcacctggcagtttcggactct
ctctacgcagcgtccctgccgctgttggtttattactacgcccggggtgaccactggcca
tttagcacggtgctctgcaagctggtgcgtttcctcttctacaccaacctctactgcagc
atcctcttcctcacctgcatcagcgtgcaccggtgcctgggagtcctgcgccctctgcac
tccctgcgttggggccgggcccgttatgcccgccgggtggctgcggttgtgtgggtgctg
gtgctggcctgccaggcacccgtgctctacttcgtcaccaccagcgtgcggggaacccgg
atcacttgccatgacacctcggcccgagagctctttagccattttgtggcttacagctcc
gtcatgctgggtctgctttttgctgtgcccttttccgtaatcctggtctgttacgtgctt
atggccaggcggctgctcaaaccggcttatgggaccacaggaggtctgcctcgggccaag
cgcaagtctgtgcgcaccattgccttggtactggccgtcttcgccctctgcttcctgcct
ttccacctcacgcgcaccctctactactccttccgatcacttgacctcagctgccacacc
ctcaacgccatcaacatggcatataagatcacccggccgctggccagcgccaacagttgt
cttgacccggtactctacttcctggcagggcagagacttgtccgctttgcccgagatgcc
aagccacccacggagcctacccccagcccacaggctcgtcgcaagctgggcctgcacagg
cctaacagaactgtgaggaaagatttgtcagtcagcagtgacgactcaagacggacagag
tccacaccagctggaagtgagactaaggacattcggctatag

DBGET integrated database retrieval system