KEGG   Mus musculus (mouse): 18442Help
Entry
18442             CDS       T01002                                 

Gene name
P2ry2, P2U1, P2Y2
Definition
(RefSeq) purinergic receptor P2Y, G-protein coupled 2
  KO
K04269  
purinergic receptor P2Y, G protein-coupled, 2
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18442 (P2ry2)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18442 (P2ry2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    18442 (P2ry2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F1
AA seq 373 aa AA seqDB search
MAADLEPWNSTINGTWEGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNVVALYIFLC
RLKTWNASTTYMFHLAVSDSLYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTR
ITCHDTSARELFSHFVAYSSVMLGLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAK
RKSVRTIALVLAVFALCFLPFHLTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTEPTPSPQARRKLGLHRPNRTVRKDLSVSSDDSRRTE
STPAGSETKDIRL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagacctggaaccctggaatagcaccatcaatggcacctgggagggggacgaa
ctgggatacaagtgtcgtttcaacgaggacttcaagtacgtgctgttgcccgtgtcctat
ggcgtggtgtgcgtgctcgggttgtgcctgaacgtcgtggctctctatatcttcctatgc
cgcctcaaaacctggaacgcctccaccacctacatgtttcacctggcagtttcggactct
ctctacgcagcgtccctgccgctgttggtttattactacgcccggggtgaccactggcca
tttagcacggtgctctgcaagctggtgcgtttcctcttctacaccaacctctactgcagc
atcctcttcctcacctgcatcagcgtgcaccggtgcctgggagtcctgcgccctctgcac
tccctgcgttggggccgggcccgttatgcccgccgggtggctgcggttgtgtgggtgctg
gtgctggcctgccaggcacccgtgctctacttcgtcaccaccagcgtgcggggaacccgg
atcacttgccatgacacctcggcccgagagctctttagccattttgtggcttacagctcc
gtcatgctgggtctgctttttgctgtgcccttttccgtaatcctggtctgttacgtgctt
atggccaggcggctgctcaaaccggcttatgggaccacaggaggtctgcctcgggccaag
cgcaagtctgtgcgcaccattgccttggtactggccgtcttcgccctctgcttcctgcct
ttccacctcacgcgcaccctctactactccttccgatcacttgacctcagctgccacacc
ctcaacgccatcaacatggcatataagatcacccggccgctggccagcgccaacagttgt
cttgacccggtactctacttcctggcagggcagagacttgtccgctttgcccgagatgcc
aagccacccacggagcctacccccagcccacaggctcgtcgcaagctgggcctgcacagg
cctaacagaactgtgaggaaagatttgtcagtcagcagtgacgactcaagacggacagag
tccacaccagctggaagtgagactaaggacattcggctatag

DBGET integrated database retrieval system