KEGG   Mus musculus (mouse): 18453Help
Entry
18453             CDS       T01002                                 

Gene name
P4hb, ERp59, PDI, Pdia1, Thbp
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    18453 (P4hb)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     18453 (P4hb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   18453 (P4hb)
  Exosomal proteins of colorectal cancer cells
   18453 (P4hb)
  Exosomal proteins of bladder cancer cells
   18453 (P4hb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 D-E; 11 84.27 cM
AA seq 509 aa AA seqDB search
MLSRALLCLALAWAARVGADALEEEDNVLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTA
GREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEA
IDDIPFGITSNSGVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQ
EVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
GDDEDLDLEEALEPDMEEDDDQKAVKDEL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccgtgctttgctgtgcctagccctggcctgggcggctagggtgggcgccgac
gccctggaggaggaggacaacgtcctggtgttgaagaagagcaacttcgaggaggcgctg
gcggcgcacaagtacctgctggtggagttctatgccccgtggtgtggccactgcaaagct
ctggctcccgagtatgccaaagctgccgcaaaactgaaggcagaaggctctgagattcga
ctagcaaaggtggatgccacagaagagtctgacctggctcagcagtatggtgtccgtggc
taccccacaatcaagttcttcaagaatggagacacagcctccccaaaggaatatacagct
ggcagggaagctgatgacattgtcaactggctgaagaaacgcacgggcccagcagctaca
accctgtctgacactgcagctgcagagtccttggtggactcaagcgaagtgacggtcatc
ggtttcttcaaggacgtagagtcagactctgccaagcagttcttgctggcagcagaggct
attgatgacataccttttggaatcacgtccaacagtggtgtgttctccaagtaccagctg
gacaaagatggggtggtcctctttaagaagtttgatgaaggccgcaacaactttgagggt
gagatcaccaaggagaagcttctagacttcatcaagcacaatcagctgcctttggtcatc
gagttcactgaacagacagctccgaagatttttggaggtgagatcaagacacacattctg
ctgttcctgcccaagagtgtatctgactatgacggcaagctgagcagcttcaagagagca
gccgagggcttcaagggcaagatcctatttatcttcatcgatagcgaccacactgataac
cagcgcatacttgagttctttggcctgaagaaggaggagtgtcccgctgtgcggcttatt
accctagaggaagagatgaccaagtacaaaccagagtcagatgagctgacggctgagaaa
atcacagagttttgccaccgcttcttagagggcaagatcaagccccacctgatgagccaa
gaagtgcctgaagactgggacaaacagccggtaaaagtactggttggggcgaactttgaa
gaggtcgcttttgatgagaaaaagaacgtgtttgttgaattctatgccccttggtgtggt
cactgcaagcagctagcccccatttgggataaactgggagagacatacaaggatcatgag
aatatcatcattgctaagatggactcaacagccaatgaggtggaagctgtcaaagtacat
agctttcccacactgaagttcttcccagcaagtgcagacagaacggtcattgattacaac
ggcgagcggacactggacggttttaagaaattcttggagagtggtggccaggatggagca
ggggacgatgaggacctcgacctagaagaagctttagagccagacatggaggaagacgac
gatcagaaagctgtgaaggatgaactgtag

DBGET integrated database retrieval system