KEGG   Mus musculus (mouse): 18453Help
Entry
18453             CDS       T01002                                 

Gene name
P4hb, ERp59, PDI, Pdia1, Thbp
Definition
(RefSeq) prolyl 4-hydroxylase, beta polypeptide
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    18453 (P4hb)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     18453 (P4hb)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   18453 (P4hb)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    18453 (P4hb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   18453 (P4hb)
  Exosomal proteins of colorectal cancer cells
   18453 (P4hb)
  Exosomal proteins of bladder cancer cells
   18453 (P4hb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6 ERp29_N Thioredoxin_8 AhpC-TSA Redoxin Thioredoxin_3 HyaE
Motif
Other DBs
NCBI-GeneID: 18453
NCBI-ProteinID: NP_035162
MGI: 97464
Ensembl: ENSMUSG00000025130
Vega: OTTMUSG00000004095
UniProt: P09103
Position
11 E2; 11 84.27 cM
AA seq 509 aa AA seqDB search
MLSRALLCLALAWAARVGADALEEEDNVLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTA
GREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEA
IDDIPFGITSNSGVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQ
EVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
GDDEDLDLEEALEPDMEEDDDQKAVKDEL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccgtgctttgctgtgcctagccctggcctgggcggctagggtgggcgccgac
gccctggaggaggaggacaacgtcctggtgttgaagaagagcaacttcgaggaggcgctg
gcggcgcacaagtacctgctggtggagttctatgccccgtggtgtggccactgcaaagct
ctggctcccgagtatgccaaagctgccgcaaaactgaaggcagaaggctctgagattcga
ctagcaaaggtggatgccacagaagagtctgacctggctcagcagtatggtgtccgtggc
taccccacaatcaagttcttcaagaatggagacacagcctccccaaaggaatatacagct
ggcagggaagctgatgacattgtcaactggctgaagaaacgcacgggcccagcagctaca
accctgtctgacactgcagctgcagagtccttggtggactcaagcgaagtgacggtcatc
ggtttcttcaaggacgtagagtcagactctgccaagcagttcttgctggcagcagaggct
attgatgacataccttttggaatcacgtccaacagtggtgtgttctccaagtaccagctg
gacaaagatggggtggtcctctttaagaagtttgatgaaggccgcaacaactttgagggt
gagatcaccaaggagaagcttctagacttcatcaagcacaatcagctgcctttggtcatc
gagttcactgaacagacagctccgaagatttttggaggtgagatcaagacacacattctg
ctgttcctgcccaagagtgtatctgactatgacggcaagctgagcagcttcaagagagca
gccgagggcttcaagggcaagatcctatttatcttcatcgatagcgaccacactgataac
cagcgcatacttgagttctttggcctgaagaaggaggagtgtcccgctgtgcggcttatt
accctagaggaagagatgaccaagtacaaaccagagtcagatgagctgacggctgagaaa
atcacagagttttgccaccgcttcttagagggcaagatcaagccccacctgatgagccaa
gaagtgcctgaagactgggacaaacagccggtaaaagtactggttggggcgaactttgaa
gaggtcgcttttgatgagaaaaagaacgtgtttgttgaattctatgccccttggtgtggt
cactgcaagcagctagcccccatttgggataaactgggagagacatacaaggatcatgag
aatatcatcattgctaagatggactcaacagccaatgaggtggaagctgtcaaagtacat
agctttcccacactgaagttcttcccagcaagtgcagacagaacggtcattgattacaac
ggcgagcggacactggacggttttaagaaattcttggagagtggtggccaggatggagca
ggggacgatgaggacctcgacctagaagaagctttagagccagacatggaggaagacgac
gatcagaaagctgtgaaggatgaactgtag

DBGET integrated database retrieval system