KEGG   Mus musculus (mouse): 18478Help
Entry
18478             CDS       T01002                                 

Gene name
Pah, AW106920
Definition
(RefSeq) phenylalanine hydroxylase (EC:1.14.16.1)
  KO
K00500  
phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    18478 (Pah)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    18478 (Pah)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    18478 (Pah)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     18478 (Pah)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 43.64 cM; 10 C2-D1
AA seq 453 aa AA seqDB search
MAAVVLENGVLSRKLSDFGQETSYIEDNSNQNGAVSLIFSLKEEVGALAKVLRLFEENEI
NLTHIESRPSRLNKDEYEFFTYLDKRSKPVLGSIIKSLRNDIGATVHELSRDKEKNTVPW
FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYT
EEERKTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGF
RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSSFGELQYCLSD
KPKLLPLELEKTACQEYTVTEFQPLYYVAESFNDAKEKVRTFAATIPRPFSVRYDPYTQR
VEVLDNTQQLKILADSINSEVGILCHALQKIKS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgttgtcctggagaacggagtcctgagcagaaaactctcagactttgggcag
gaaacaagttacatcgaagacaactccaatcaaaatggtgctgtatctctgatattctca
ctcaaagaggaagttggtgccctggccaaggtcctgcgcttatttgaggagaatgagatc
aacctgacacacattgaatccagaccttcccgtttaaacaaagatgagtatgagtttttc
acctatctggataagcgtagcaagcccgtcctgggcagcatcatcaagagcctgaggaac
gacattggtgccactgtccatgagctttcccgagacaaggaaaagaacacagtgccctgg
ttcccaaggaccattcaggagctggacagattcgccaatcagattctcagctatggagcc
gaactggatgcagaccacccaggctttaaagatcctgtgtaccgggcgagacgaaagcag
tttgctgacattgcctacaactaccgccatgggcagcccattcctcgggtggaatacaca
gaggaggagaggaagacctggggaacggtgttcaggactctgaaggccttgtataaaaca
catgcctgctacgagcacaaccacatcttccctcttctggaaaagtactgcggtttccgt
gaagacaacatcccgcagctggaagatgtttctcagtttctgcagacttgtactggtttc
cgcctccgtcctgttgctggcttactgtcgtctcgagatttcttgggtggcctggccttc
cgagtcttccactgcacacagtacattaggcatggatctaagcccatgtacacacctgaa
cctgatatctgtcatgaactcttgggacatgtgcccttgttttcagatagaagctttgcc
cagttttctcaggaaattgggcttgcatcgctgggggcacctgatgagtacattgagaaa
ctggccacaatttactggtttactgtggagtttgggctttgcaaggaaggagattctata
aaggcatatggtgctgggctcttgtcatcctttggagaattacagtactgtttatcagac
aagccaaagctcctgcccctggagctagagaagacagcctgccaggagtatactgtcaca
gagttccagcctctgtactatgtggccgagagtttcaatgatgccaaggagaaagtgagg
acttttgctgccacaatcccccggcccttctccgttcgctatgacccctacactcaaagg
gttgaggtcctggacaatactcagcagttgaagattttagctgactccattaatagtgag
gttggaatcctttgccatgccctgcagaaaataaagtcatga

DBGET integrated database retrieval system