KEGG   Mus musculus (mouse): 18519Help
Entry
18519             CDS       T01002                                 

Gene name
Kat2b, A930006P13Rik, AI461839, AW536563, Pcaf, p/CAF
Definition
(RefSeq) K(lysine) acetyltransferase 2B (EC:2.3.1.48)
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    18519 (Kat2b)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    18519 (Kat2b)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    18519 (Kat2b)
  Infectious diseases
   05166 HTLV-I infection
    18519 (Kat2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     18519 (Kat2b)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     18519 (Kat2b)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    18519 (Kat2b)
   HAT complexes
    PCAF complex
     18519 (Kat2b)
    STAGA complex
     18519 (Kat2b)
    TFTC complex
     18519 (Kat2b)
    SAGA complex
     18519 (Kat2b)
    SLIK complex
     18519 (Kat2b)
    ADA-HAT complex
     18519 (Kat2b)
    HAT-A2 complex
     18519 (Kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 C; 17 27.86 cM
AA seq 813 aa AA seqDB search
MAEAGGAGSPALPPAPPHGSPRTLATAAGSSASCGPATAVAAAGTAEGPGGGGSARIAVK
KAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRS
CSHALAAHVSHLENVSEEEMDRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSI
LQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYW
HLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTI
MRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSP
LGIQTVISPPVTGTALFSSNSTSHEQINGGRTSPGCRGSSGLEANPGEKRKMNNSHAPEE
AKRSRVMGDIPVELINEVMSTITDPAGMLGPETNFLSAHSARDEAARLEERRGVIEFHVV
GNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGIC
FRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKK
QGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQA
QIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPKDPEQLYSTLKNILQQV
KNHPNAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLRNRYYVSKKLFMADLQRVFTNC
KEYNPPESEYYKCASILEKFFFSKIKEAGLIDK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggctggcggggccgggtccccagcactgcctcccgcgcccccgcacggttcc
ccccggaccctggccaccgctgccgggagctctgcttcctgcgggccagcgaccgcggtg
gccgcggcgggcacggccgagggaccgggaggaggcggctcggcccggatcgccgtgaag
aaggcgcagttgcgctctgctccgcgggcgaagaagctggagaaactcggcgtgtactcc
gcctgcaaggcagaggagtcctgtaaatgcaatggctggaagaaccctaacccctctcct
actccaccaagaggagacctccagcagataattgtcagtttgacagaatcctgtcgaagc
tgtagccatgcccttgctgctcacgtttctcacttggagaatgtgtcagaggaagagatg
gacagactcctgggaattgtgttggatgtggagtacctcttcacctgcgtccacaaagaa
gaagatgcagataccaaacaagtgtacttctacctattcaagctcttgagaaagtcaatt
ttacaaagaggaaaacctgtggttgaaggctccttggagaagaagccgccatttgagaag
cccagtattgaacagggtgtgaacaacttcgtgcagtacaagtttagtcacttgccatcg
aaagagaggcagacaacgatcgagctggccaagatgtttctgaaccgcatcaactactgg
catctggaggctccatctcagcggagactacggtctcccaatgatgacatctctggatac
aaggaaaactacacaaggtggttgtgctactgcaatgtaccgcagttctgtgacagctta
cctcggtacgaaaccacaaaggtgtttgggagaacattgcttcgctcggtcttcaccatc
atgagacgacagctcttggaacaagccagacaggaaaaagacaaactgcctcttgagaaa
cgcacgcttatcctcacacatttcccaaagtttctgtccatgttggaagaagaagtgtat
agtcaaaattctcctatctgggatcaggattttctctcagcctcttccagaaccagcccg
ctaggaatccaaacagtaatcagtcctcctgttactgggacagcattgttcagttcaaat
tccacttcccatgagcagatcaatggagggagaacaagtcctggatgcagaggctcttct
gggcttgaagcaaacccgggagaaaagaggaaaatgaacaactctcatgctcccgaggag
gccaagagatctcgagtgatgggggatattcccgtggaattgatcaatgaggtcatgtct
accatcacagaccctgcagggatgcttggaccagagaccaattttctgtcagcccattcg
gccagagatgaggcggcacggctggaagaacgcaggggtgtcattgaattccacgtggtg
ggcaactccctgaaccagaaaccaaacaagaagatcctgatgtggctcgtgggcctccag
aatgtgttttcccaccagctgcccagaatgcccaaagagtacatcacacggctcgtcttt
gacccgaaacacaaaacccttgctttaattaaagatggccgtgtcattggtggtatctgt
ttccggatgtttccatcccagggattcacagagattgttttctgtgcagtaacctcaaat
gaacaagtcaagggctatggaacccacctgatgaaccatctcaaagaataccacataaag
cacgagatcctcaacttcctcacatatgcagatgagtatgccatcggctatttcaagaag
cagggtttctccaaagaaatcaaaatacctaaaaccaaatatgttggctacatcaaggat
tatgaaggggccactttgatgggatgtgagctgaaccctcagatcccatacacagagttc
tctgtcatcattaaaaagcagaaggagatcattaaaaagctgatagaaagaaaacaagcc
cagattcgaaaagtctaccctggactttcgtgtttcaaagatggagttcggcagattcct
atagaaagcattcctggaatcagagagacaggctggaaaccaagtggaaaagagaaaagt
aaagagcccaaagaccctgagcagctttacagcaccctcaagaacatcctgcagcaggtg
aagaaccatccaaatgcttggcctttcatggaaccagtgaagagaacagaagctccggga
tattatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctcaggaac
aggtactatgtgtctaagaagttattcatggcggacttgcaacgagtgttcaccaactgc
aaggagtacaaccctcccgagagcgagtactacaaatgcgccagcatcctggagaagttc
ttcttcagtaaaattaaggaagcagggttgattgacaagtga

DBGET integrated database retrieval system