KEGG   Mus musculus (mouse): 18534Help
Entry
18534             CDS       T01002                                 

Gene name
Pck1, AI265463, PEPCK, Pck-1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase 1, cytosolic (EC:4.1.1.32)
  KO
K01596  
phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
PPAR signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Proximal tubule bicarbonate reclamation
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18534 (Pck1)
   00020 Citrate cycle (TCA cycle)
    18534 (Pck1)
   00620 Pyruvate metabolism
    18534 (Pck1)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    18534 (Pck1)
   04151 PI3K-Akt signaling pathway
    18534 (Pck1)
   04152 AMPK signaling pathway
    18534 (Pck1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    18534 (Pck1)
   04922 Glucagon signaling pathway
    18534 (Pck1)
   04920 Adipocytokine signaling pathway
    18534 (Pck1)
   03320 PPAR signaling pathway
    18534 (Pck1)
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    18534 (Pck1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    18534 (Pck1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     18534 (Pck1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 95.79 cM; 2 C1-qter
AA seq 622 aa AA seqDB search
MPPQLHNGLDFSAKVIQGSLDSLPQAVRKFVEGNAQLCQPEYIHICDGSEEEYGQLLAHM
QEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGISV
LEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPSL
PGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDAEPCAHPNSRFCTPASQCPIIDPAW
ESPEGVPIEGIIFGGRRPEGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPF
AMRPFFGYNFGKYLAHWLSMAHRPAAKLPKIFHVNWFRKDKDGKFLWPGFGENSRVLEWM
FGRIEGEDSAKLTPIGYIPKENALNLKGLGGVNVEELFGISKEFWEKEVEEIDRYLEDQV
NTDLPYEIERELRALKQRISQM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcagctgcataacggtctggacttctctgccaaggtcatccagggcagcctc
gacagcctgccccaggcagtgaggaagttcgtggaaggcaatgctcagctgtgccagccg
gagtatatccacatctgcgatggctccgaggaggagtacgggcagttgctggcccacatg
caggaggagggtgtcatccgcaagctgaagaaatatgacaactgttggctggctctcact
gaccctcgagatgtggccaggatcgaaagcaagacagtcatcatcacccaagagcagaga
gacacagtgcccatccccaaaactggcctcagccagctgggccgctggatgtcggaagag
gactttgagaaagcattcaacgccaggttcccagggtgcatgaaaggccgcaccatgtat
gtcatcccattcagcatggggccactgggctcgccgctggccaagattggtattgaactg
acagactcgccctatgtggtggccagcatgcggatcatgactcggatgggcatatctgtg
ctggaggccctgggagatggggagttcatcaagtgcctgcactctgtggggtgccctctc
cccttaaaaaagcctttggtcaacaactgggcctgcaaccctgagctgaccctgatcgcc
cacctcccggaccgcagagagatcatctcctttggaagcggatatggtgggaactcacta
ctcgggaagaaatgctttgcgttgcggatcgccagccgtctggctaaggaggaagggtgg
ctggcggagcatatgctgatcctgggcataactaaccccgaaggcaagaagaaatacctg
gccgcagccttccctagtgcctgtgggaagactaacttggccatgatgaaccccagcctg
cccgggtggaaggtcgaatgtgtgggcgatgacattgcctggatgaagtttgatgcccaa
ggcaacttaagggctatcaacccagaaaacgggttttttggagttgctcctggcacctca
gtgaagacaaatccaaatgccattaaaaccatccagaaaaacaccatcttcaccaacgtg
gccgagactagcgatgggggtgtttactgggaaggcatcgatgagccgctggccccggga
gtcaccatcacctcctggaagaacaaggagtggagaccgcaggacgcggaaccatgtgcc
catcccaactcgagattctgcacccctgccagccagtgccccattattgaccctgcctgg
gaatctccagaaggagtacccattgagggtatcatctttggtggccgtagacctgaaggt
gtcccccttgtctatgaagccctcagctggcagcatggggtgtttgtaggagcagccatg
agatctgaggccacagctgctgcagaacacaagggcaagatcatcatgcacgaccccttt
gccatgcgacccttcttcggctacaacttcggcaaatacctggcccactggctgagcatg
gcccaccgcccagcagccaagttgcccaagatcttccatgtcaactggttccggaaggac
aaagatggcaagttcctctggccaggctttggcgagaactcccgggtgctggagtggatg
ttcgggcggattgaaggggaagacagcgccaagctcacgcccatcggctacatccctaag
gaaaacgccttgaacctgaaaggcctggggggcgtcaacgtggaggagctgtttgggatc
tctaaggagttctgggagaaggaggtggaggagatcgacaggtatctggaggaccaggtc
aacaccgacctcccttacgaaattgagagggagctccgagccctgaaacagagaatcagc
cagatgtaa

DBGET integrated database retrieval system