KEGG   Mus musculus (mouse): 18537Help
Entry
18537             CDS       T01002                                 

Gene name
Pcmt1, C79501, PIMT
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase 1 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     18537 (Pcmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
10 A1; 10 2.26 cM
AA seq 285 aa AA seqDB search
MPGARIGGSGSDGSNSGRSSGDTSGAVTVWEVVSLLGKLLGTVAALKVVLYLLRVCFAMA
WKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKSNPYMDSPQSIGFQATISAP
HMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGNSGKVIGIDHIKELVDDSITN
VKKDDPMLLSSGRVRLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILP
VGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagcgcgcattggcggcagtggcagcgacggcagtaacagcggccgctcgagc
ggggacaccagcggggcggtgaccgtgtgggaggtggtctcactcttggggaaactgcta
gggaccgtcgccgcgctgaaggtggttctgtacctgctccgggtgtgcttcgcgatggcc
tggaaatccggcggcgccagccactcggagctaatccacaacctccgcaagaatggaatc
atcaagacagataaagtatttgaagtgatgctggctacagaccgttcccactatgcaaaa
tctaacccttacatggattctccacaatcaataggtttccaggcaacaatcagtgcccct
catatgcacgcatatgcactagaacttctgtttgaccagctgcatgaaggtgctaaagcc
ctggacgtgggctctggaagtggaatcctcaccgcctgttttgcacggatggttggaaat
agtggaaaagtcattggaattgatcacattaaagaactagtagatgactcaataactaat
gtcaaaaaggatgacccaatgctcctgtcctcggggcgagtgcggctggtggtgggtgat
ggaagaatgggatacgctgaagaagccccttacgacgctattcatgtgggagctgcagcc
ccagttgtgccccaggcattaatagaccagttaaagcctggtggaagattgatattgcca
gtcggtcctgcaggaggaaaccaaatgttggagcagtatgacaagctacaagatggcagt
gtcaaaatgaaacctctcatgggggtgatatacgtgcctttaacagataaagaaaagcag
tggtccaggtggaagtga

DBGET integrated database retrieval system