KEGG   Mus musculus (mouse): 18555Help
Entry
18555             CDS       T01002                                 

Gene name
Cdk16, Crk5, Pctaire1, Pctk1
Definition
(RefSeq) cyclin-dependent kinase 16 (EC:2.7.11.22)
  KO
K08820  
cyclin-dependent kinase 16 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     18555 (Cdk16)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   18555 (Cdk16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X A1.3; X 16.18 cM
AA seq 496 aa AA seqDB search
MDRMKKIKRQLSMTLRGGRGIDKTNGVPEQIGLDESGGGGGSDLGEAPTRIAPGELRSVR
GPLSSAPEIVHEDMKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSL
PADIRLPEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVY
KGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVF
EYLDKDLKQYLDDCGNVINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGEL
KLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRP
LFPGSTVEEQLHFIFRILGTPTEETWPGILSNEEFRTYNYPKYRAEALLSHAPRLDSDGA
DLLTKLLQFEGRNRISAEDARKHPFFLSLGERIHKLPDTTSIFALKEVQLQKEANIRSTS
MPDSGRPAFRVVDTEF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggatcggatgaagaagatcaaacggcagctgtcaatgacactccgagggggccgaggc
atagataagaccaatggtgtccctgagcagataggcctggatgagagtggtggcggtggt
ggcagtgaccttggagaagctcccacccgtattgcccctggggagcttcgctctgttcgg
ggcccactcagctctgcaccagagattgtgcacgaggacatgaagatgggatctgatggg
gagagtgaccaggcttcagccacatcctcagatgaggtgcagtctccagtgagagtgcgc
atgcgcaaccaccccccacgcaagatctccactgaggacatcaacaaacgcctgtcacta
ccagctgacatacggctgcctgagggctaccttgagaagctgaccctcaatagccccatc
tttgataagcctcttagccggcgcctccgccgagtcagtttgtctgagattggctttgga
aaactggagacctacatcaagctagacaagctgggtgagggtacctatgccactgtctac
aaaggcaaaagcaagctcacagacaaccttgtagcacttaaggagatcagactggaacac
gaagaaggggcaccctgtactgctatccgggaagtatccctgcttaaggacctcaagcat
gccaacatcgtcacactacatgacattatccacacagagaagtccctcacacttgtcttt
gaatacttggacaaggacctgaagcagtacctggatgactgtggaaatgtcatcaacatg
cacaatgtgaaactgttcctgttccagttgctccgtggcctggcctactgccacaggcag
aaggtgctacaccgagacctcaagccccagaacctactcatcaacgagaggggagagctc
aaactggcagattttggcctggctcgtgccaagtcaattcctactaaaacatactccaac
gaagtggtgacactgtggtaccggccccctgacatcctacttgggtccacagactactct
acccaaattgacatgtggggtgtaggctgcatcttctatgagatggccaccggccggccc
ctcttcccaggctccacagtggaagaacagctgcacttcatcttccgcattttgggaacc
ccaactgaggagacatggccaggtatcctgtccaatgaggagtttagaacatacaactac
cccaagtaccgagccgaggcccttctgagccatgcaccccgacttgatagcgatggagct
gacctcctcaccaagctgctgcagtttgagggtcgcaatcggatctctgctgaggatgcc
aggaaacatccattctttctcagcttgggggagcggatccacaaacttcctgacactact
tccatatttgcactaaaggaggtacagctacaaaaggaggccaacattcggtccacttct
atgcctgactcaggcaggccagctttccgtgtggtggataccgagttctaa

DBGET integrated database retrieval system