KEGG   Mus musculus (mouse): 18569Help
Entry
18569             CDS       T01002                                 

Gene name
Pdcd4, D19Ucla1, Ma3, Tis
Definition
(RefSeq) programmed cell death 4
  KO
K16865  
programmed cell death protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
Proteoglycans in cancer
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    18569 (Pdcd4)
   05205 Proteoglycans in cancer
    18569 (Pdcd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19 D2; 19 48.73 cM
AA seq 469 aa AA seqDB search
MDIENEQTLNVNPTDPDNLSDSLFSGDEENAGTEEIKNEINGNWISASTINEARINAKAK
RRLRKNSSRDSGRGDSVSDNGSEAVRSGVAVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDETAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTNDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggatatagaaaatgagcagacactgaatgtgaaccccactgaccctgacaatttaagc
gactctctcttttctggagatgaagaaaatgctggcactgaagaaataaagaatgaaata
aatggaaattggatttccgcatctactattaatgaagctagaatcaatgcaaaagccaaa
agacgactgcggaaaaattcatcccgggactctggccgaggagactcagtcagtgacaat
ggaagtgaagcggttagaagtggagttgctgtgcccaccagtccaaaaggaaggttgcta
gataggcggtccagatctgggaaaggaagggggctgccaaagaaaggtggtgcaggcggc
aagggtgtctggggcacacctggacaggtgtatgatgtggaagaggtggatgtgaaagat
ccaaactatgatgacgaccaggagaactgtgtttatgaaactgtagttttgcccctggat
gagaccgcatttgagaagactctaacaccaattatacaggaatactttgagcatggagat
acaaatgaagttgcggagatgttaagagacttaaaccttggggagatgaagagtggcgtg
ccggtgttggcagtgtccttagccttggaggggaaggccagccaccgggagatgacatcc
aagctgctttctgacctttgcgggacggtgatgagcacaaatgacgtggaaaagtcattt
gacaagttgctgaaggatctccctgagctagccttggacactcctagggcaccgcagttg
gtgggccagtttattgctagagctgttggagatggaatcttatgtaatacctatatcgat
agttacaaaggaactgtagattgtgtacaggctcgagctgctctggataaggctactgtg
ctcctgagtatgtccaaaggcgggaagcggaaagacagtgtgtggggatctggaggcggg
caacagcctgtcaatcaccttgttaaagagattgatatgctgcttaaagagtatttactc
tctggagatatatctgaagctgaacactgccttaaggaactggaagtacctcattttcac
cacgagcttgtatatgaagccattgtaatggttttagagtcaactggagaaagtgcattc
aagatgatcttagatttattaaaatccttgtggaagtcttctactattaccatagaccaa
atgaaaagaggctatgagagaatttacaatgaaatcccagacattaatctggatgtccca
cactcatactctgttcttgagagatttgtggaggaatgttttcaggctggaataatttcc
aaacaactccgtgatctttgtccatcaaggggaagaaagcgttttgtaagtgaaggagat
ggaggccgtcttaaacctgagagctactga

DBGET integrated database retrieval system