KEGG   Mus musculus (mouse): 18601Help
Entry
18601             CDS       T01002                                 

Gene name
Padi3, AI507004, Pad3, Pdi3, mKIAA4171
Definition
peptidyl arginine deiminase, type III (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     18601 (Padi3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 E1; 4 72.5 cM
AA seq 664 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETIVDIYGAVPEGTDMFEVYGTPGVDIYVSPSMERSR
ERADTRRWCFNKGLEIIVIMNSPSNDLNDSHVQIAYHSSREHLPLAYAVLYLTCVDITLD
CDMNCADRQDRSFVDKRQWVWGPDGYGAILLVNCDRDNVDSNAQDNCDQYVRCLQDLEDM
SVMVLRTQGPEALFEDHRLILHTSSCDAERARVFHVCGPEDSCESYKCVLGPDRMSYEVP
RLKGYEERFFVEGLSFPDAGFPGLISFHVTLLDDSNEDFSETPIFTDTAVFRVAPWIMTP
STLPPLEVYVCRVRNNTCFVEAVEELARKAGCKLTICPQAENRNDRWIQDEMELGYVQAP
HKTLPVVFDSPRNGELQGFPYKRILGLDFGYVTREPKDSSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSRGRRVTQVVRNFLHAQKVQPLVELFVDWLAVGHVDEFLSFVPA
PDGKGFRLLLASPGACFRLFQEKQKWGHGRSLLFEGVIGDRRVQTVSINQILNNQSLINF
NKFAQSCIDWNREVLKRELGLAEGDIIDIPQLFKTEKRKAVAFFPDLVNMLVLGKHLGIP
KPFGPIINGRCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVRREPFAFKWW
HMVP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctctacagaggattgtgcgtgtgtctctggagcaccccaccagcgctgtgtgtgtg
gcaggggttgagaccatcgtggacatttatggggcggttcctgagggcacagacatgttt
gaggtctacgggacaccgggagtggacatctatgtgtctcccagcatggagaggagccga
gagcgagctgacaccaggcggtggtgcttcaacaagggcctggagattattgtaatcatg
aactcccctagcaatgacctcaacgacagccatgttcagatagcctaccactccagccga
gagcatttgcccctggcctatgcagtactctacctcacctgtgtggacatcaccctagac
tgtgacatgaactgtgcggaccggcaggacaggagcttcgtggataagaggcagtgggtg
tgggggcctgatgggtacggagccatcttgctggtgaactgtgatcgggacaatgtcgac
tctaatgcccaagataactgtgaccaatatgtgcgttgcctgcaagatctggaagacatg
tccgtcatggtcctacggacccagggccccgaagccctctttgaggaccacaggcttatc
ctccacacctccagctgtgatgcagagcgggcacgggtcttccatgtctgcggccccgag
gattcctgtgagtcctataagtgtgttctgggcccagacaggatgtcctatgaggtgccc
cgcctgaagggctatgaggagcgcttcttcgtggagggcctctccttcccggatgcaggc
ttcccagggctcatttccttccatgtcactctgctggatgattctaatgaggacttctcc
gagacccccatcttcaccgacacagcagtgttccgggtggccccctggatcatgacaccc
agcaccctgccacccctagaggtgtacgtgtgccgggtgaggaataacacctgctttgtg
gaagccgtggaggagctggctaggaaggcgggctgcaaactcaccatctgtcctcaggca
gagaaccggaacgaccgctggatccaggatgagatggagctggggtatgtgcaggcgcca
cacaagaccttgccggtggtcttcgattctccgaggaacggagagctgcagggcttccct
tacaaaaggatcctgggtctagatttcggctatgtgacacgggaacctaaagacagttct
gtgagtggtctggactcttttggcaacctggaggtcagcccacccgtggtggccaatggg
aaggagtatcccttggggagaatcctcatcgggggcaacctgcctgggtcgagaggccgc
agagtgacccaggtggtgcgaaacttcctccatgcccagaaagtgcaacctctggtggag
ctgtttgtggactggctggctgtgggccacgtggatgagttcctgagcttcgtccctgca
cccgacgggaagggcttccggctcctcctggccagccctggcgcctgcttcaggctattc
caggaaaagcagaagtggggccatggccggtccctgcttttcgagggtgtcattggcgac
aggcgggtccagaccgtctccatcaatcagattcttaacaaccagagccttatcaacttt
aataagtttgcacagagctgtatcgactggaaccgcgaggtactgaagcgggagctgggc
ctggcggagggtgacatcatcgacatcccgcagctcttcaagacggagaagaggaaggca
gtagcgttcttccccgacttggtgaatatgctggtcctgggcaagcacctgggcatcccc
aagcccttcgggcccatcatcaatggtcgctgctgcctggaggagaaggtgcgctccctg
ctggagccgctgggtctgcactgcaccttcatcgatgacttcacgccataccacatgctg
cacggggaggttcactgtggcaccaacgtgcgccgggagcccttcgccttcaagtggtgg
cacatggtgccctga

DBGET integrated database retrieval system