KEGG   Mus musculus (mouse): 18604Help
Entry
18604             CDS       T01002                                 

Gene name
Pdk2
Definition
pyruvate dehydrogenase kinase, isoenzyme 2 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     18604 (Pdk2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   18604 (Pdk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 D; 11 59.01 cM
AA seq 407 aa AA seqDB search
MRWVRALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLGTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCSVSDVVKDAYDMAKLLCDKYYMASPDLEIQEVNATNANQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLTLPPIKIMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgggtccgggcgctgttgaagaatgcgtccctggcaggggcacccaagtacatc
gagcacttcagcaagttctccccgtccccgttgtccatgaagcagtttctagacttcgga
tccagcaatgcctgcgagaagacgtcattcactttcctccggcaggagctgcccgttcgc
ctggccaacatcatgaaagagatcaacctgcttcctgaccgagtgctgggcaccccatcg
gtgcagctggtgcagagctggtatgtccagagtctgctggacatcatggaattcctggac
aaagaccccgaggaccaccggactctaagccagttcacagatgccctggtcaccatccgg
aaccggcacaatgacgtggtgcccaccatggcacagggagtgctggagtacaaggacacc
tatggagatgaccccgtctccaaccagaacatccagtacttcctggaccgcttctacctc
agccgcatctccatccgaatgctaatcaatcaacacaccctcatctttgatggcagcacc
aacccagcccaccccaaacacattggcagcatcgatcccaactgcagcgtgtctgatgtg
gtgaaagacgcctatgacatggctaagctcctgtgtgacaagtattacatggcttcccct
gacctggagatccaggaagtcaatgccaccaacgccaaccagcccattcacatggtctat
gtcccttcccacctgtaccacatgctctttgaactctttaagaatgccatgcgggccact
gtggaaagccacgagtccagcctcacactcccccccatcaagattatggtggccctcggt
gaagaagatctgtccatcaaaatgagtgaccgaggcgggggtgtccccttgaggaagatc
gagaggctcttcagctacatgtactccacagctcccacaccccagcctggcactgggggt
accccgctggctggctttgggtacggactccccatttcccgcctctacgccaagtacttc
cagggggacttgcagcttttctctatggagggctttgggacagatgctgtcatctatctg
aaggccctgtccacggactcagtggagcgcctgcctgtctacaacaagtctgcctggcgc
cactaccagaccatccaggaggccggcgactggtgtgtgcccagcacagagcccaagaac
acatcgacgtatcgggtcagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system