KEGG   Mus musculus (mouse): 18607Help
Entry
18607             CDS       T01002                                 

Gene name
Pdpk1, Pdk1
Definition
(RefSeq) 3-phosphoinositide dependent protein kinase 1 (EC:2.7.11.1)
  KO
K06276  
3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Focal adhesion
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Insulin resistance
Aldosterone-regulated sodium reabsorption
Toxoplasmosis
Hepatitis C
Proteoglycans in cancer
Endometrial cancer
Prostate cancer
Non-small cell lung cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    18607 (Pdpk1)
   04071 Sphingolipid signaling pathway
    18607 (Pdpk1)
   04151 PI3K-Akt signaling pathway
    18607 (Pdpk1)
   04152 AMPK signaling pathway
    18607 (Pdpk1)
   04150 mTOR signaling pathway
    18607 (Pdpk1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    18607 (Pdpk1)
  Cellular commiunity
   04510 Focal adhesion
    18607 (Pdpk1)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    18607 (Pdpk1)
   04664 Fc epsilon RI signaling pathway
    18607 (Pdpk1)
  Endocrine system
   04910 Insulin signaling pathway
    18607 (Pdpk1)
   03320 PPAR signaling pathway
    18607 (Pdpk1)
   04919 Thyroid hormone signaling pathway
    18607 (Pdpk1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18607 (Pdpk1)
  Nervous system
   04722 Neurotrophin signaling pathway
    18607 (Pdpk1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    18607 (Pdpk1)
   05205 Proteoglycans in cancer
    18607 (Pdpk1)
   05215 Prostate cancer
    18607 (Pdpk1)
   05213 Endometrial cancer
    18607 (Pdpk1)
   05223 Non-small cell lung cancer
    18607 (Pdpk1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    18607 (Pdpk1)
  Infectious diseases
   05160 Hepatitis C
    18607 (Pdpk1)
   05145 Toxoplasmosis
    18607 (Pdpk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18607 (Pdpk1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  PDK1 family
   18607 (Pdpk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 A3.3
AA seq 559 aa AA seqDB search
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGVSRQGSTMDGTTAEAR
PSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRH
IIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF
DETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQA
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKL
EYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPK
LTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIH
DLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
LTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCR
KIQEVWRQQYQSNPDAAVQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgctgtgcccattcagtccagtgtggtgcta
tgttcctgcccatccccatcaatggtgaggtcccagactgagcccggttcgtcccctggc
attcctagtggtgttagcaggcagggatccaccatggatggcaccacagctgaagcccga
ccaagcaccaaccccttgcagcagcaccctgcccagctgccaccacagcctcgcaagaaa
cgccctgaagacttcaagtttgggaaaattcttggcgagggctctttttcaacagttgtt
ctggcccgagaactggccacttccagagaatatgctattaaaattctggagaaacgtcat
attataaaagaaaacaaagttccgtatgtaactagagagagagatgtgatgtcacgcctg
gatcaccccttctttgtgaaactttattttacatttcaggacgacgaaaagctgtatttt
ggccttagttatgccaaaaatggagagctacttaaatacatccgcaaaattggctcattt
gatgagacctgtacccggttttacacggctgagattgtgtctgctttagagtacttgcat
ggcaagggcatcattcacagagaccttaaaccagaaaacattttgttaaatgaagacatg
cacatccagatcacagattttggaacagcaaaagtgttatccccagagagcaaacaagcc
agggccaactcatttgtaggaacagcacagtatgtttctccagagctgctcacagagaag
tcggcgtgtaaaagttcagacctttgggcccttggatgtataatctatcagctcgtggca
ggactcccaccattcagagccgggaatgaatatcttatatttcagaagatcattaagctg
gaatatcatttcccagaaaaattcttccctaaggctagagatcttgtggaaaaactcttg
gttttagatgccacaaagcgtttaggctgtgaagagatggaagggtacgggcctctcaaa
gctcatccattctttgagaccatcacttgggagaatttgcaccagcagacacctccgaag
ctcacagcttacctaccagccatgtcagaggatgatgaagactgctatggcaactacgac
aatctcctgagccagtttggcttcatgcaggtgtcatcctcctcctcttcccactccctg
tctacggtggaaaccagcctgccccagaggtcgggcagcaacatagagcagtacatccat
gatttggacactaactcttttgaactagacttacagttttcagaagatgaaaaaaggttg
ttattggaaaagcaagccggtggaaacccttggcaccagtttgtagaaaataatctaata
ttaaaaatgggtccagtggataagcgaaagggtttatttgcaagacgacgacagttatta
ctcacagaagggccacatttatattatgttgatcctgtcaacaaggtcttgaaaggtgaa
atcccatggtcacaagaactccgaccagaagccaagaattttaaaactttctttgtccac
acgcctaacaggacgtactacctgatggatccaagcgggaatgctcacaagtggtgcaga
aagatccaggaggtttggaggcagcagtaccagagcaatccagatgctgctgtgcagtga

DBGET integrated database retrieval system