KEGG   Mus musculus (mouse): 18642Help
Entry
18642             CDS       T01002                                 

Gene name
Pfkm, AI131669, PFK-A, PFK-M, Pfk-4, Pfk4, Pfka, Pfkx
Definition
phosphofructokinase, muscle (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mmu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mmu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mmu00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 F1; 15
AA seq 780 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLNDLQKDGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVRPPVSKGGLHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKNLEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSI
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHISRKRSGEAAV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcatcatgcagccaaaaccctggggatcggcaaggccatcgccgtg
ttgacctctggtggagatgcccaaggtatgaatgctgccgtcagggctgtggtccgagtt
ggtatcttcacgggcgcccgcgtcttctttgtccatgagggttaccaaggcctggtggac
ggtggcgagcacatcagggaggccacgtgggagagcgtgtctatgatgcttcagctgggt
ggcacagtgattggaagtgcccgatgcaaggacttccgagagcgagaaggacgactccgg
gccgcccacaacctggtgaagcgggggatcaccaatctgtgtgtcatcggaggcgatggc
agcctcactggggctgacactttccgttcagagtggagcgacttgctgaatgatctccag
aaagacgggaagatcacagccgaggaggctacaaagtccagctacctgaacatcgtgggc
ctggttggctcaatcgacaatgacttctgtggcactgatatgaccattggtaccgactct
gccctgcacaggattgtggagatcgtagacgccatcaccaccacggctcagagccaccag
aggacgtttgtgttagaagtgatgggccgccactgtggatacctggcccttgtcacctct
ctgtcctgtggggccgactgggtttttattcctgagtgtccgccagacgatgactgggaa
gaacacctttgtcgccggctcagtgagacaaggacccgtggctctcgtctcaacatcatc
attgttgctgaaggtgccatcgacaagaacgggaagccaatcacctcagaagacatcaag
aacctggtggtgaagcgccttggatatgacacccgggtcactgttctgggacatgtacag
cggggtgggacaccatcagcctttgaccggatcctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccagacaccccagcctgtgtggtgagcctctctggt
aaccaggctgtgcgtttgcccctcatggagtgcgtgcaggtgaccaaagacgtgaccaag
gctatggatgagaagagatttgatgaagccattaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctagctcatgtcagacccccagtctctaagggtgggttg
cacacagtggccgtgatgaatgtgggggccccagctgctggcatgaatgccgctgttcgc
tctaccgtgaggattggccttatccagggcaaccgggtgctggtcgtacatgatggcttt
gagggtctggccaaaggtcagattgaggaggctggctggagctatgttggaggctggact
ggtcaaggtggttccaaacttggtactaaaaggactctccccaagaagaacctggaacag
atcagtgccaacataaccaagtttaacatccagggccttgtcatcattgggggctttgag
gcttacacagggggcttggagctgatggaaggcaggaagcagtttgatgagctctgcatc
ccgtttgtggtcattccggccacggtttccaataacgtccctgggtcagacttcagcatc
ggggctgacacagcactgaacaccatctgcacgacttgtgaccgaatcaagcagtctgca
gcaggcaccaaacgtcgggtgtttatcatcgagactatgggtggctactgtggctacctg
gccaccatggcagggctggccgctggggctgatgctgcctacatttttgaggaacccttc
accattcgcgatctccaggtgaatgttgaacatctggtgcagaagatgaaaacaactgtg
aagagaggcctggtgctgaggaatgagaaatgcaatgagaactacactactgacttcatt
ttcaacctgtactctgaggaggggaagggcatctttgatagcaggaagaacgtgcttggc
cacatgcagcagggtggaagcccaactccctttgacaggaattttgccactaagatgggt
gctaaggctatgaactggatgtctgggaaaatcaaggagagttaccgtaatggacggatc
tttgccaacacccctgactcaggctgcgttctggggatgcgtaagagggccctggtcttt
cagccagtaactgagctgaaggaccagacagactttgaacaccgaatccccaaagaacag
tggtggctgaagctgaggccaatcctcaaaatcctagccaagtacgagattgatctggac
acctccgaccacgcccacctggagcacatttcaaggaaacggtctggagaagccgccgtc
tag

DBGET integrated database retrieval system