KEGG   Mus musculus (mouse): 18642Help
Entry
18642             CDS       T01002                                 

Gene name
Pfkm, AI131669, PFK-A, PFK-M, Pfk-4, Pfk4, Pfka, Pfkx
Definition
phosphofructokinase, muscle (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    18642 (Pfkm)
   01230 Biosynthesis of amino acids
    18642 (Pfkm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18642 (Pfkm)
   00030 Pentose phosphate pathway
    18642 (Pfkm)
   00051 Fructose and mannose metabolism
    18642 (Pfkm)
   00052 Galactose metabolism
    18642 (Pfkm)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    18642 (Pfkm)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     18642 (Pfkm)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     18642 (Pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 F1; 15
AA seq 780 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLNDLQKDGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVRPPVSKGGLHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKNLEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSI
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHISRKRSGEAAV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcatcatgcagccaaaaccctggggatcggcaaggccatcgccgtg
ttgacctctggtggagatgcccaaggtatgaatgctgccgtcagggctgtggtccgagtt
ggtatcttcacgggcgcccgcgtcttctttgtccatgagggttaccaaggcctggtggac
ggtggcgagcacatcagggaggccacgtgggagagcgtgtctatgatgcttcagctgggt
ggcacagtgattggaagtgcccgatgcaaggacttccgagagcgagaaggacgactccgg
gccgcccacaacctggtgaagcgggggatcaccaatctgtgtgtcatcggaggcgatggc
agcctcactggggctgacactttccgttcagagtggagcgacttgctgaatgatctccag
aaagacgggaagatcacagccgaggaggctacaaagtccagctacctgaacatcgtgggc
ctggttggctcaatcgacaatgacttctgtggcactgatatgaccattggtaccgactct
gccctgcacaggattgtggagatcgtagacgccatcaccaccacggctcagagccaccag
aggacgtttgtgttagaagtgatgggccgccactgtggatacctggcccttgtcacctct
ctgtcctgtggggccgactgggtttttattcctgagtgtccgccagacgatgactgggaa
gaacacctttgtcgccggctcagtgagacaaggacccgtggctctcgtctcaacatcatc
attgttgctgaaggtgccatcgacaagaacgggaagccaatcacctcagaagacatcaag
aacctggtggtgaagcgccttggatatgacacccgggtcactgttctgggacatgtacag
cggggtgggacaccatcagcctttgaccggatcctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccagacaccccagcctgtgtggtgagcctctctggt
aaccaggctgtgcgtttgcccctcatggagtgcgtgcaggtgaccaaagacgtgaccaag
gctatggatgagaagagatttgatgaagccattaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctagctcatgtcagacccccagtctctaagggtgggttg
cacacagtggccgtgatgaatgtgggggccccagctgctggcatgaatgccgctgttcgc
tctaccgtgaggattggccttatccagggcaaccgggtgctggtcgtacatgatggcttt
gagggtctggccaaaggtcagattgaggaggctggctggagctatgttggaggctggact
ggtcaaggtggttccaaacttggtactaaaaggactctccccaagaagaacctggaacag
atcagtgccaacataaccaagtttaacatccagggccttgtcatcattgggggctttgag
gcttacacagggggcttggagctgatggaaggcaggaagcagtttgatgagctctgcatc
ccgtttgtggtcattccggccacggtttccaataacgtccctgggtcagacttcagcatc
ggggctgacacagcactgaacaccatctgcacgacttgtgaccgaatcaagcagtctgca
gcaggcaccaaacgtcgggtgtttatcatcgagactatgggtggctactgtggctacctg
gccaccatggcagggctggccgctggggctgatgctgcctacatttttgaggaacccttc
accattcgcgatctccaggtgaatgttgaacatctggtgcagaagatgaaaacaactgtg
aagagaggcctggtgctgaggaatgagaaatgcaatgagaactacactactgacttcatt
ttcaacctgtactctgaggaggggaagggcatctttgatagcaggaagaacgtgcttggc
cacatgcagcagggtggaagcccaactccctttgacaggaattttgccactaagatgggt
gctaaggctatgaactggatgtctgggaaaatcaaggagagttaccgtaatggacggatc
tttgccaacacccctgactcaggctgcgttctggggatgcgtaagagggccctggtcttt
cagccagtaactgagctgaaggaccagacagactttgaacaccgaatccccaaagaacag
tggtggctgaagctgaggccaatcctcaaaatcctagccaagtacgagattgatctggac
acctccgaccacgcccacctggagcacatttcaaggaaacggtctggagaagccgccgtc
tag

DBGET integrated database retrieval system