KEGG   Mus musculus (mouse): 18643Help
Entry
18643             CDS       T01002                                 

Gene name
Pfn1, Pfn
Definition
profilin 1
Orthology
K05759  
profilin
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:mmu04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:mmu05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B4; 11 43.21 cM
AA seq 140 aa AA seqDB search
MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacagccttatggcggacgggacctgtcaggacgcg
gccatcgtaggctacaaggactcgccctccgtctgggccgccgtccccgggaagaccttc
gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagttttttc
gtcaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcaa
gacggggaatttacaatggatcttcgtaccaagagcaccggaggagcccccaccttcaat
gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagtac
tga

DBGET integrated database retrieval system