KEGG   Mus musculus (mouse): 18643Help
Entry
18643             CDS       T01002                                 

Gene name
Pfn1, Pfn
Definition
profilin 1
Orthology
K05759  
profilin
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    18643 (Pfn1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    18643 (Pfn1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    18643 (Pfn1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   18643 (Pfn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B4; 11 43.21 cM
AA seq 140 aa AA seqDB search
MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacagccttatggcggacgggacctgtcaggacgcg
gccatcgtaggctacaaggactcgccctccgtctgggccgccgtccccgggaagaccttc
gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagttttttc
gtcaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcaa
gacggggaatttacaatggatcttcgtaccaagagcaccggaggagcccccaccttcaat
gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagtac
tga

DBGET integrated database retrieval system