KEGG   Mus musculus (mouse): 18646Help
Entry
18646             CDS       T01002                                 

Gene name
Prf1, Pfn, Pfp, Prf-1
Definition
(RefSeq) perforin 1 (pore forming protein)
  KO
K07818  
perforin 1
Organism
mmu  Mus musculus (mouse)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    18646 (Prf1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    18646 (Prf1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    18646 (Prf1)
   05330 Allograft rejection
    18646 (Prf1)
   05332 Graft-versus-host disease
    18646 (Prf1)
  Cardiovascular diseases
   05416 Viral myocarditis
    18646 (Prf1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    18646 (Prf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10 B4; 10 32.18 cM
AA seq 554 aa AA seqDB search
MATCLFLLGLFLLLPRPVPAPCYTATRSECKQKHKFVPGVWMAGEGMDVTTLRRSGSFPV
NTQRFLRPDRTCTLCKNSLMRDATQRLPVAITHWRPHSSHCQRNVAAAKVHSTEGVAREA
AANINNDWRVGLDVNPRPEANMRASVAGSHSKVANFAAEKTYQDQYNFNSDTVECRMYSF
RLVQKPPLHLDFKKALRALPRNFNSSTEHAYHRLISSYGTHFITAVDLGGRISVLTALRT
CQLTLNGLTADEVGDCLNVEAQVSIGAQASVSSEYKACEEKKKQHKMATSFHQTYRERHV
EVLGGPLDSTHDLLFGNQATPEQFSTWTASLPSNPGLVDYSLEPLHTLLEEQNPKREALR
QAISHYIMSRARWQNCSRPCRSGQHKSSHDSCQCECQDSKVTNQDCCPRQRGLAHLVVSN
FRAEHLWGDYTTATDAYLKVFFGGQEFRTGVVWNNNNPRWTDKMDFENVLLSTGGPLRVQ
VWDADYGWDDDLLGSCDRSPHSGFHEVTCELNHGRVKFSYHAKCLPHLTGGTCLEYAPQG
LLGDPPGNRSGAVW
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtgcctgttcctcctgggccttttcctgctgctgccacgacctgtccctgct
ccctgctacactgccactcggtcagaatgcaagcagaagcacaagttcgtgccaggtgta
tggatggctggggaaggcatggatgtgactaccctccgccgctccggctccttcccagtg
aacacacagaggttcctgaggcctgaccgcacctgcaccctctgtaaaaactccctaatg
agagacgccacacagcgcctacctgtggcaatcacccactggcggcctcacagctcacac
tgccagcgtaatgtggccgcagccaaggtccactccacggagggtgtggcccgggaggca
gctgctaatatcaataacgactggcgtgtggggctggatgtgaaccctaggccagaggca
aacatgcgcgcctccgtggctggctcccactccaaggtagccaattttgcagctgagaag
acctatcaggaccagtacaactttaatagcgacacagtagagtgtcgcatgtacagtttt
cgcctggtacaaaaacctccactccaccttgacttcaaaaaggcgctcagagccctcccc
cgcaactttaacagctccacagagcatgcttaccacaggctcatctcctcctatggcacg
cactttatcacggctgtggacctcggtggccgcatctcggtccttacagccctgcgtacc
tgtcagctgaccctgaatgggctcacagctgatgaggtaggagactgcctgaacgtggag
gcccaggtcagcatcggtgcccaagccagcgtctccagtgaatacaaagcttgtgaggag
aagaagaaacagcacaaaatggccacctctttccaccagacctaccgtgagcgtcacgtc
gaagtacttggtggccctctggactccacgcatgatctgctcttcgggaaccaagctaca
ccagagcagttctcaacctggacagcctcactgcccagcaaccctggtctggtggactac
agcctggagcccctgcacacattactggaagaacagaacccgaagcgggaggctctgaga
caggctatcagccattatataatgagcagagcccggtggcagaactgtagcaggccctgc
aggtcaggccagcataagagtagccatgattcatgccagtgtgagtgccaggattcaaag
gtcaccaaccaggactgctgcccacgacagaggggcttggcccatttggtggtaagcaat
ttccgggcagaacatctgtggggagactacaccacagctactgatgcctacctaaaggtc
ttctttggtggccaggagttcaggaccggtgtcgtgtggaacaataacaatccccggtgg
actgacaagatggactttgagaatgtgctcctgtccacagggggacccctcagggtgcag
gtctgggatgccgactacggctgggatgatgaccttcttggttcttgtgacaggtctccc
cactctggtttccatgaggtgacatgtgagctaaaccacggcagggtgaaattctcctac
catgccaagtgtctgccccatctcactggagggacctgcctggagtatgccccccagggg
cttctgggagatcctccaggaaaccgcagtggggctgtgtggtaa

DBGET integrated database retrieval system