KEGG   Mus musculus (mouse): 18648Help
Entry
18648             CDS       T01002                                 

Gene name
Pgam1, 2310050F24Rik, Pgam-1
Definition
(RefSeq) phosphoglycerate mutase 1 (EC:3.1.3.13 5.4.2.4 5.4.2.11)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    18648 (Pgam1)
   01230 Biosynthesis of amino acids
    18648 (Pgam1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18648 (Pgam1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    18648 (Pgam1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    18648 (Pgam1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    18648 (Pgam1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     18648 (Pgam1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   18648 (Pgam1)
  Exosomal proteins of melanoma cells
   18648 (Pgam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 C3; 19
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKVKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctacaagctggtgctgatccggcatggcgagagcgcctggaacctggagaac
cgcttcagcggctggtacgacgccgacctgagcccggcgggccacgaggaggcgaagcgc
ggcgggcaggcgttgcgagatgctggctatgaatttgacatctgcttcacctctgtgcag
aagagagcaatccggaccctctggacagtcctggatgccattgaccagatgtggttgcca
gtggtcaggacttggcgcctcaatgagcgacactatggcggtctgacaggtctcaacaaa
gcagaaactgctgctaagcatggtgaggcccaggtaaagatctggagacgatcttatgat
gtcccaccgcctcccatggagcctgatcaccccttctacagcaacatcagcaaggatcgc
aggtacgcagaccttactgaagaccagctcccctcctgtgagagcctgaaggacactatt
gccagagcactgcccttctggaatgaagaaattgtcccccagatcaaagaggggaaaagg
gtcttgattgccgcccacggcaacagccttcggggcatcgttaagcatctggagggtctc
tcagaagaggccatcatggagctgaacctgcccacgggcatccctatcgtctatgaactg
gacaagaacttgaagcccatcaagcccatgcagttcctgggagacgaggagaccgtgcgc
aaagccatggaagctgtggctgctcagggcaaggtgaagaagtga

DBGET integrated database retrieval system