KEGG   Mus musculus (mouse): 18673Help
Entry
18673             CDS       T01002                                 

Gene name
Phb, Bap32
Definition
(RefSeq) prohibitin
  KO
K17080  
prohibitin 1
Organism
mmu  Mus musculus (mouse)
Brite
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Mitochondrial movement
    18673 (Phb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   18673 (Phb)
  Exosomal proteins of breast cancer cells
   18673 (Phb)
  Exosomal proteins of colorectal cancer cells
   18673 (Phb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 59.01 cM; 11 D
AA seq 272 aa AA seqDB search
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPW
VQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLP
SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFT
EAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK
LEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaagtgtttgagtccattggaaagttcggcctggcgttggcagttgcagga
ggcgtggtgaactctgctttgtataatgtggatgctggacacagagctgtcatctttgac
cgattccgtggcgtacaggacattgtggtcggggaagggactcatttcctcatcccttgg
gtacagaaaccaattatctttgactgccgctctcgaccacggaacgtaccagtcatcact
ggtagcaaagacttgcagaacgtcaatatcacactgcgaatcctcttccggccggtggcc
agccagcttcctcgtatctacaccagcattggcgaggactatgatgagcgggtcctgcct
tctatcaccacagagatcctcaagtcggtggtggctcgattcgatgctggagaattgatt
acccagcgagagctggtctccaggcaggtgagcgatgacctcacagagcgagcggcaaca
tttgggcttatcctggatgacgtgtccctgacacatctgaccttcgggaaggagttcaca
gaggcagtagaagccaaacaggtggctcagcaggaagcggagagagccagatttgtggtg
gaaaaggctgagcagcagaagaaggcagccatcatctctgctgagggtgactccaaggcc
gctgagctgatcgccaactcgctggccacggcaggcgacggcctgatcgagctgcggaag
ctggaggccgccgaggacattgcgtaccagctctcccgctctcggaacatcacctacctg
ccagcgggccagtccgtgcttctccagcttccccagtga

DBGET integrated database retrieval system