KEGG   Mus musculus (mouse): 18674Help
Entry
18674             CDS       T01002                                 

Gene name
Slc25a3, 5730556H19Rik, PTP, Phc
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 3
  KO
K15102  
solute carrier family 25 (mitochondrial phosphate transporter), member 3
Organism
mmu  Mus musculus (mouse)
Brite
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   18674 (Slc25a3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18674 (Slc25a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10; 10 C2
AA seq 357 aa AA seqDB search
MFSSVAHLARANPFNAPHLQLVHDGLSGPRSPPAPPRRSRHLAAAAVEEYSCEFGSMKYY
ALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAP
TLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSASAEFFADIALAPMEA
AKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPYTMMKFACFERTVEAL
YKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTASQVLQR
LGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgtccgtagcgcacctggcgcgggcgaaccccttcaacgcgccacacctgcag
ctggtgcacgatggcctgtcgggtccccgcagtcccccagctccgccccggcgttcccgc
cacctggccgccgccgccgtggaagagtacagttgtgaatttggctccatgaagtattat
gcactgtgtggctttggtggggtcttaagttgtgggctgacacacactgctgttgttccc
ctggacttagtaaagtgccgcatgcaggtggaccctcagaagtacaaaggcatatttaat
ggattctccattacactgaaagaagatggcgttcgtggtttggctaaaggatgggcccca
actttgattggctattccatgcaagggctctgcaaattcggcttttatgaagtcttcaaa
gccttatatagcaacatacttggtgaggaaaacacctacctgtggcgcacatcactgtat
ttagcttcttctgccagtgctgaattcttcgctgacattgccctggctcctatggaagct
gctaaagttcgaattcaaacccagcctggttatgccaacaccttgagggaagctgttccc
aaaatgtataaagaggaaggcttaaatgcgttctacaagggcgttgctcctctgtggatg
agacagatcccgtacaccatgatgaagttcgcctgctttgaacgtactgttgaagctttg
tacaaatttgtggttcctaagccccgaagtgaatgtacaaaggcagagcagctggttgtg
acatttgtggcaggttacatagctggagtcttctgtgcgatcgtctcccaccctgctgac
tctgtggtctctgtgctgaataaagagaaaggcagcaccgcgtctcaggtcctgcagagg
ctgggcttcagaggtgtgtggaaggggctcttcgcccgaatcatcatgattggcactctg
actgcactacagtggttcatctacgactctgtgaaggtctacttcaggctccctcgccct
cctccccctgagatgccagagtctctgaagaagaagcttgggttaactgagtag

DBGET integrated database retrieval system