KEGG   Mus musculus (mouse): 18682Help
Entry
18682             CDS       T01002                                 

Gene name
Phkg1, Phkg
Definition
(RefSeq) phosphorylase kinase gamma 1 (EC:2.7.11.1 2.7.11.19 2.7.11.26)
  KO
K00871  
phosphorylase kinase gamma subunit [EC:2.7.11.19]
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    18682 (Phkg1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    18682 (Phkg1)
   04922 Glucagon signaling pathway
    18682 (Phkg1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.19  phosphorylase kinase
     18682 (Phkg1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  PHK family
   18682 (Phkg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G1.3; 5 68.26 cM
AA seq 388 aa AA seqDB search
MTRDDALPDSHSAQTFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFS
SEEVQELREATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLTEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLQPGEK
LREVCGTPSYLAPEIIQCSMDDGHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMDGKYQFGSPEWDDYSDTVKDLVSRFLVVQPQDRCSAEEALAHPFFQEYVVEEVRHFS
PRGKFKVICLTVLASVKIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEEDF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggatgacgccctccctgactcgcattctgcacagactttctacgagaactat
gagcccaaggagatcctgggcaggggagtcagcagtgtggtcaggcgctgcatccacaaa
cccacatgccaggaatacgcagtgaaaatcattgacatcaccggaggaggaagctttagc
tctgaggaggtacaggagcttcgggaagccaccctgaaggaggtggacatcctgcagaag
gtctcgggacaccccaacatcatacagctgaaggacacttacgagaccaacactttcttc
ttcttggtatttgatctgatgaagagaggggaactctttgactatctcactgagaaggtc
accttaaccgagaaggaaaccagaaagatcatgcgggccctgctggaggtgatctgtacc
ctgcacaaactcaacattgtccatcgggacctgaagccggagaatatccttttggatgac
aacatgaatataaagctcacagacttcgggttttcctgccagctgcagccaggagagaag
ctccgagaggtttgtgggactcccagttatctggcccctgaaatcatacagtgctccatg
gacgacggccatcctggctatgggaaggaggtggacatgtggagcacaggcgtcatcatg
tacactctgctggctggctccccgcctttctggcaccggaagcaaatgctgatgttgcgg
atgatcatggacggcaaataccagtttggctcaccagagtgggatgactactctgacaca
gtgaaagacttggtgtctcgattcttggtggtgcaacctcaggaccgctgctcggcggaa
gaggccttggcacaccctttctttcaggagtacgtagtagaagaagtacggcacttcagc
ccccgagggaagttcaaggtgatctgtctaactgtgctggcatcagtaaagatctactac
cagtaccgtcgggtgaagccggtaaccagggagatcgtcatccgagacccctacgccctt
cggccgctgcggaggctcattgacgcctatgctttccgtatctacggccactgggtgaag
aaagggcaacagcagaacagagccgccctcttcgagaacacgcccaaggctgtgctcctc
tccttggctgaggaggaggacttctga

DBGET integrated database retrieval system