KEGG   Mus musculus (mouse): 18703Help
Entry
18703             CDS       T01002                                 

Gene name
Pigr
Definition
(RefSeq) polymeric immunoglobulin receptor
  KO
K13073  
polymeric immunoglobulin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    18703 (Pigr)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   18703 (Pigr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 56.89 cM; 1 E3
AA seq 771 aa AA seqDB search
MRLYLFTLLVTVFSGVSTKSPIFGPQEVSSIEGDSVSITCYYPDTSVNRHTRKYWCRQGA
SGMCTTLISSNGYLSKEYSGRANLINFPENNTFVINIEQLTQDDTGSYKCGLGTSNRGLS
FDVSLEVSQVPELPSDTHVYTKDIGRNVTIECPFKRENAPSKKSLCKKTNQSCELVIDST
EKVNPSYIGRAKLFMKGTDLTVFYVNISHLTHNDAGLYICQAGEGPSADKKNVDLQVLAP
EPELLYKDLRSSVTFECDLGREVANEAKYLCRMNKETCDVIINTLGKRDPDFEGRILITP
KDDNGRFSVLITGLRKEDAGHYQCGAHSSGLPQEGWPIQTWQLFVNEESTIPNRRSVVKG
VTGGSVAIACPYNPKESSSLKYWCRWEGDGNGHCPVLVGTQAQVQEEYEGRLALFDQPGN
GTYTVILNQLTTEDAGFYWCLTNGDSRWRTTIELQVAEATREPNLEVTPQNATAVLGETF
TVSCHYPCKFYSQEKYWCKWSNKGCHILPSHDEGARQSSVSCDQSSQLVSMTLNPVSKED
EGWYWCGVKQGQTYGETTAIYIAVEERTRGSSHVNPTDANARAKVALEEEVVDSSISEKE
NKAIPNPGPFANEREIQNVGDQAQENRASGDAGSADGQSRSSSSKVLFSTLVPLGLVLAV
GAIAVWVARVRHRKNVDRMSISSYRTDISMADFKNSRDLGGNDNMGASPDTQQTVIEGKD
EIVTTTECTAEPEESKKAKRSSKEEADMAYSAFLLQSSTIAAQVHDGPQEA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgaggctctacttgttcacgctcttggtaactgtcttttcaggggtctccacaaaaagc
cccatatttggtccccaggaggtgagtagtatagaaggcgactctgtttccatcacgtgc
tactacccagacacctctgtcaaccggcacacccggaaatactggtgccgacaaggagcc
agcggcatgtgcacaacgctcatctcttcaaatggctacctctccaaggagtattcaggc
agagccaacctcatcaacttcccagagaacaacacatttgtgattaacattgagcagctc
acccaggacgacactgggagctacaagtgtggcctgggtaccagtaaccgaggcctgtcc
ttcgatgtcagcctggaggtcagccaggttcctgagttgccgagtgacacccacgtctac
acaaaggacataggcagaaatgtgaccattgaatgccctttcaaaagggagaatgctccc
agcaagaaatccctgtgtaagaagacaaaccagtcctgcgaacttgtcattgactctact
gagaaggtgaaccccagctatataggcagagcaaaactttttatgaaagggaccgaccta
actgtattctatgtcaacattagtcacctaacgcacaatgatgctgggctgtacatctgc
caagctggagaaggtcctagtgctgataagaagaatgttgacctccaggtgctagcgcct
gagccagagctgctttataaagacctgaggtcctcagtgacttttgaatgtgacctgggc
cgtgaggtggcaaacgaggccaaatatctgtgccggatgaataaggaaacctgtgatgtg
atcattaacaccctggggaagagggatccagactttgagggcaggatcctgataaccccc
aaggatgacaatggccgcttcagtgtgttgatcacaggcctgaggaaggaggatgcaggg
cactaccagtgtggagcccacagttctggtttgcctcaagaaggctggcccatccagact
tggcaactctttgtcaatgaagagtctaccattcccaatcgtcgctctgttgtgaaggga
gtcacaggaggctctgtggccatcgcctgtccctataaccccaaggaaagcagcagcctc
aagtactggtgtcgctgggaaggggacggaaatggacattgccccgtgcttgtggggacc
caggcccaggtgcaagaagagtatgaaggccgactggcactgtttgatcagccaggcaat
ggtacttacactgtcatcctcaaccagctcaccaccgaggatgctggcttctattggtgt
cttaccaatggtgactctcgctggagaaccacaatagaactccaggttgccgaagctaca
agggagccaaaccttgaggtgacgccacagaacgcaacagcagtactaggagagaccttc
accgtttcctgccactatccgtgcaaattctactcccaggagaaatactggtgcaagtgg
agcaacaagggttgccacatcctgccaagccatgacgaaggtgcccgccaatcttctgtg
agctgcgaccagagcagccagctggtctccatgaccctgaacccggtcagtaaggaagat
gaaggctggtactggtgtggggtaaagcaaggccagacctatggagaaactaccgccatc
tatatagcagttgaagagaggaccagagggtcatcccatgtcaacccaacagatgcaaat
gcacgtgccaaagtcgctctggaagaagaggtagtggactcctccatcagtgaaaaagag
aacaaagccattccaaatcccgggccttttgccaacgaaagagagatacagaatgtggga
gaccaagctcaggagaacagagcatctggggatgctggcagtgctgatggacaaagcagg
agctccagctccaaagtgctgttctccaccctggtgcccctgggtctggtgctggcagtg
ggtgctatagctgtgtgggtggccagagtccgacatcggaagaatgtagaccgcatgtca
atcagcagctacaggacagacattagcatggcagacttcaagaactccagagatttggga
ggcaatgacaacatgggggcctctccagacacacagcaaacagtcatcgaaggaaaagat
gaaatcgtgactaccacggagtgcaccgctgagccagaagaatccaagaaagcaaaaagg
tcatccaaggaggaagctgacatggcctactcggcattcctgcttcagtccagcaccata
gctgcacaggtccacgatggtccccaggaagcctag

DBGET integrated database retrieval system