KEGG   Mus musculus (mouse): 18712Help
Entry
18712             CDS       T01002                                 

Gene name
Pim1, Pim-1
Definition
(RefSeq) proviral integration site 1
  KO
K04702  
proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Jak-STAT signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
MicroRNAs in cancer
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    18712 (Pim1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    18712 (Pim1)
   05206 MicroRNAs in cancer
    18712 (Pim1)
   05221 Acute myeloid leukemia
    18712 (Pim1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    18712 (Pim1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18712 (Pim1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  PIM family [OT]
   18712 (Pim1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 A3.3; 17 15.38 cM
AA seq 313 aa AA seqDB search
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSDFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEDLARGFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRG
EIKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIKGQVFFRQTVSSECQHLIKWCLSLRPSDRPSFEEIRNHPWMQGDLLPQAAS
EIHLHSLSPGSSK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgtccaagatcaactccctggcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgccgggcaaagagaaggagcccctggagtcgcagtaccaggtg
ggcccgctgttgggcagcggtggcttcggctcggtctactctggcatccgcgtcgccgac
aacttgccggtggccattaagcacgtggagaaggaccggatttccgattggggagaactg
cccaatggcacccgagtgcccatggaagtggtcctgttgaagaaggtgagctcggacttc
tcgggcgtcattagacttctggactggttcgagaggcccgatagtttcgtgctgatcctg
gagaggcccgaaccggtgcaagacctcttcgactttatcaccgaacgaggagccctacag
gaggacctggcccgaggattcttctggcaggtgctggaggccgtgcggcattgccacaac
tgcggggttctccaccgcgacatcaaggacgagaacatcttaatcgacctgagccgcggc
gaaatcaaactcatcgacttcgggtcgggggcgctgctcaaggacacagtctacacggac
tttgatgggacccgagtgtacagtcctccagagtggattcgctaccatcgctaccacggc
aggtcggcagctgtctggtcccttgggatcctgctctatgacatggtctgcggagatatt
ccgtttgagcacgatgaagagatcatcaagggccaagtgttcttcaggcaaactgtctct
tcagagtgtcagcaccttattaaatggtgcctgtccctgagaccatcagatcggccctcc
tttgaagaaatccggaaccatccatggatgcagggtgacctcctgccccaggcagcttct
gagatccatctgcacagtctgtcaccggggtccagcaagtag

DBGET integrated database retrieval system