KEGG   Mus musculus (mouse): 18712Help
Entry
18712             CDS       T01002                                 

Gene name
Pim1, Pim-1
Definition
(RefSeq) proviral integration site 1 (EC:2.7.11.1)
  KO
K04702  
proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Jak-STAT signaling pathway
AGE-RAGE signaling pathway in diabetic complications
MicroRNAs in cancer
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    18712 (Pim1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    18712 (Pim1)
   05221 Acute myeloid leukemia
    18712 (Pim1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    18712 (Pim1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18712 (Pim1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  PIM family [OT]
   18712 (Pim1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 A3.3; 17 15.38 cM
AA seq 313 aa AA seqDB search
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSDFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEDLARGFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRG
EIKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIKGQVFFRQTVSSECQHLIKWCLSLRPSDRPSFEEIRNHPWMQGDLLPQAAS
EIHLHSLSPGSSK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgtccaagatcaactccctggcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgccgggcaaagagaaggagcccctggagtcgcagtaccaggtg
ggcccgctgttgggcagcggtggcttcggctcggtctactctggcatccgcgtcgccgac
aacttgccggtggccattaagcacgtggagaaggaccggatttccgattggggagaactg
cccaatggcacccgagtgcccatggaagtggtcctgttgaagaaggtgagctcggacttc
tcgggcgtcattagacttctggactggttcgagaggcccgatagtttcgtgctgatcctg
gagaggcccgaaccggtgcaagacctcttcgactttatcaccgaacgaggagccctacag
gaggacctggcccgaggattcttctggcaggtgctggaggccgtgcggcattgccacaac
tgcggggttctccaccgcgacatcaaggacgagaacatcttaatcgacctgagccgcggc
gaaatcaaactcatcgacttcgggtcgggggcgctgctcaaggacacagtctacacggac
tttgatgggacccgagtgtacagtcctccagagtggattcgctaccatcgctaccacggc
aggtcggcagctgtctggtcccttgggatcctgctctatgacatggtctgcggagatatt
ccgtttgagcacgatgaagagatcatcaagggccaagtgttcttcaggcaaactgtctct
tcagagtgtcagcaccttattaaatggtgcctgtccctgagaccatcagatcggccctcc
tttgaagaaatccggaaccatccatggatgcagggtgacctcctgccccaggcagcttct
gagatccatctgcacagtctgtcaccggggtccagcaagtag

DBGET integrated database retrieval system