KEGG   Mus musculus (mouse): 18720Help
Entry
18720             CDS       T01002                                 

Gene name
Pip5k1a, PI4P5K-I[a], PIP5K1-alpha, PIP5KIalpha, Pipk5a
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha (EC:2.7.1.68)
  KO
K00889  
1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
mmu  Mus musculus (mouse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Phospholipase D signaling pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Choline metabolism in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18720 (Pip5k1a)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    18720 (Pip5k1a)
   04072 Phospholipase D signaling pathway
    18720 (Pip5k1a)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    18720 (Pip5k1a)
  Cell motility
   04810 Regulation of actin cytoskeleton
    18720 (Pip5k1a)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    18720 (Pip5k1a)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    18720 (Pip5k1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     18720 (Pip5k1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 F2.1
AA seq 546 aa AA seqDB search
MASASSGPAAAGFSSLDAGAPAGTAAASGIKRATVSEGPSASVMPVKKIGHRSVDSSGET
TYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYN
DFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKT
VQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMH
MKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVL
QSFKIMDYSLLMSIHNMDHAQREPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGG
TVETEDHMGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPG
FYAERFQRFMCNTVFKKIPLKPSPTKKFRSGPSFSRRSGPSGNSCTSQLMASGEHRAQVT
TKAEVEPDVHLGRPDVLPQTPPLEEISEGSPVPGPSFSPVVGQPLQILNLSSTLEKLDVA
ESEFTH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcctcctcagggccagcggcggccgggttttcatcccttgatgccggggcc
cctgctggtaccgcagcagcatctggaatcaagagagccacagtatctgagggaccttcc
gcctctgtcatgcctgttaaaaaaataggccatcgaagtgttgattcctctggagagact
acatacaagaagacaacttcatcagccttgaaaggtgccatccagttaggcatcactcac
actgtgggcagcctgagcaccaaaccagagcgtgatgtcctcatgcaagacttctacgtg
gtggagagcatctttttccccagtgaaggcagcaacctgacaccggctcaccattacaat
gactttcgattcaagacctatgcgcctgttgccttccgttacttcagagagctctttggc
atccggcctgatgattacttgtactccctttgcagtgagccattgattgaactctccaat
tctggagctagtggttccctcttctatgtgtccagtgatgatgaattcatcattaagacc
gtccagcataaagaagcagaatttctgcagaagttgcttccaggatactacatgaatctt
aaccaaaaccctcgtactttgctgcccaaattttatggattgtactgtgtgcaagcaggc
ggcaagaacatacgaattgtggtgatgaacaatctcttgcctcggtcagtcaaaatgcat
atgaaatatgacctgaagggttcaacttacaagcggcgggcttctcagaaagaacgagag
aaaactctccccacctttaaagacctggacttcctacaagatatccctgacggcctattt
ttggatgctgacatgtacagtgctctgtgtaagactctacagcgtgactgtttggtgctg
cagagcttcaagataatggactacagcctgttgatgtccatccacaacatggaccatgca
cagagggagcccacgagcaatgacacacagtactcggctgacacgcgcagaccagcccca
cagaaggcgctctattccacagctatggaatccatccagggcgaggctcgacggggcggc
actgtggagactgaggaccacatgggtggcatccctgcccggaataacaaaggagaaagg
ctcctgctttatattggcatcattgatattcttcagtcctacaggtttgttaagaagttg
gagcactcttggaaagcactggtccatgatggggatacggtgtcagtgcatcgtccaggc
ttctatgctgagcggttccagcgtttcatgtgcaacacagtgttcaagaagattcccttg
aagccttctcctaccaaaaagtttcggtctggcccgtctttctctcggcgatcaggcccc
agcggcaactcctgcacctcccagctgatggcctctggggaacacagagcacaagtgacc
accaaggcggaagtggagccagatgtacaccttgggcgtcctgatgtcttacctcagact
ccacctttggaggaaataagtgagggttcacctgttcctggccccagtttctcacctgta
gttggacaacctttgcaaatactaaatttgagttcaaccttggaaaagcttgatgttgca
gagtcagagttcacccactga

DBGET integrated database retrieval system