KEGG   Mus musculus (mouse): 18747Help
Entry
18747             CDS       T01002                                 

Gene name
Prkaca, PKCD, Pkaca
Definition
protein kinase, cAMP dependent, catalytic, alpha (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
Amoebiasis
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    18747 (Prkaca)
   04010 MAPK signaling pathway
    18747 (Prkaca)
   04310 Wnt signaling pathway
    18747 (Prkaca)
   04340 Hedgehog signaling pathway
    18747 (Prkaca)
   04020 Calcium signaling pathway
    18747 (Prkaca)
   04024 cAMP signaling pathway
    18747 (Prkaca)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    18747 (Prkaca)
   04210 Apoptosis
    18747 (Prkaca)
  Cellular commiunity
   04540 Gap junction
    18747 (Prkaca)
 Organismal Systems
  Immune system
   04611 Platelet activation
    18747 (Prkaca)
   04062 Chemokine signaling pathway
    18747 (Prkaca)
  Endocrine system
   04911 Insulin secretion
    18747 (Prkaca)
   04910 Insulin signaling pathway
    18747 (Prkaca)
   04912 GnRH signaling pathway
    18747 (Prkaca)
   04913 Ovarian Steroidogenesis
    18747 (Prkaca)
   04915 Estrogen signaling pathway
    18747 (Prkaca)
   04914 Progesterone-mediated oocyte maturation
    18747 (Prkaca)
   04921 Oxytocin signaling pathway
    18747 (Prkaca)
   04918 Thyroid hormone synthesis
    18747 (Prkaca)
   04919 Thyroid hormone signaling pathway
    18747 (Prkaca)
   04916 Melanogenesis
    18747 (Prkaca)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    18747 (Prkaca)
   04270 Vascular smooth muscle contraction
    18747 (Prkaca)
  Digestive system
   04970 Salivary secretion
    18747 (Prkaca)
   04971 Gastric acid secretion
    18747 (Prkaca)
   04976 Bile secretion
    18747 (Prkaca)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    18747 (Prkaca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    18747 (Prkaca)
  Nervous system
   04724 Glutamatergic synapse
    18747 (Prkaca)
   04727 GABAergic synapse
    18747 (Prkaca)
   04725 Cholinergic synapse
    18747 (Prkaca)
   04728 Dopaminergic synapse
    18747 (Prkaca)
   04726 Serotonergic synapse
    18747 (Prkaca)
   04720 Long-term potentiation
    18747 (Prkaca)
   04723 Retrograde endocannabinoid signaling
    18747 (Prkaca)
  Sensory system
   04740 Olfactory transduction
    18747 (Prkaca)
   04742 Taste transduction
    18747 (Prkaca)
   04750 Inflammatory mediator regulation of TRP channels
    18747 (Prkaca)
  Environmental adaptation
   04713 Circadian entrainment
    18747 (Prkaca)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    18747 (Prkaca)
   05205 Proteoglycans in cancer
    18747 (Prkaca)
   05203 Viral carcinogenesis
    18747 (Prkaca)
  Neurodegenerative diseases
   05012 Parkinson's disease
    18747 (Prkaca)
   05020 Prion diseases
    18747 (Prkaca)
  Substance dependence
   05030 Cocaine addiction
    18747 (Prkaca)
   05031 Amphetamine addiction
    18747 (Prkaca)
   05032 Morphine addiction
    18747 (Prkaca)
   05034 Alcoholism
    18747 (Prkaca)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    18747 (Prkaca)
  Infectious diseases
   05166 HTLV-I infection
    18747 (Prkaca)
   05169 Epstein-Barr virus infection
    18747 (Prkaca)
   05146 Amoebiasis
    18747 (Prkaca)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     18747 (Prkaca)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   18747 (Prkaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8; 8 C3
AA seq 343 aa AA seqDB search
MASSSNDVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGN
HYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ
RKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagctccaacgatgtgaaagagttcctagccaaagccaaggaagatttcctg
aaaaaatgggagaccccttctcagaatacagcccagttggatcagtttgatagaatcaag
acccttggcaccggctcctttgggcgagtgatgctggtgaagcacaaggagagtgggaac
cactacgccatgaagatcttagacaagcagaaggtggtgaagctaaagcagatcgagcac
actctgaatgagaagcgcatcctgcaggccgtcaacttcccgttcctggtcaaacttgaa
ttctccttcaaggacaactcaaacctgtacatggtcatggagtatgtagctggtggcgag
atgttctcccacctacggcggattggaaggttcagcgagccccatgcccgtttctacgcg
gcgcagatcgtcctgacctttgagtatctgcactccctggacctcatctaccgggacctg
aagcccgagaatcttctcatcgaccagcagggctatattcaggtgacagacttcggtttt
gccaagcgtgtgaaaggccgtacttggaccttgtgtgggacccctgagtacttggccccc
gagattatcctgagcaaaggctacaacaaggctgtggactggtgggctctcggagtcctc
atctacgagatggctgctggttacccacccttcttcgctgaccagcctatccagatctat
gagaaaatcgtctctgggaaggtgcggttcccatcccacttcagctctgacttgaaggac
ctgctgcggaaccttctgcaggtggatctcaccaagcgctttgggaacctcaagaacggg
gtcaatgacatcaagaaccacaagtggtttgccacgactgactggattgccatctatcag
agaaaggtggaagctcccttcataccaaagtttaaaggccctggggacacgagtaacttt
gacgactatgaggaggaagagatccgggtctccatcaatgagaagtgtggcaaggagttt
actgagttttag

DBGET integrated database retrieval system