KEGG   Mus musculus (mouse): 18749Help
Entry
18749             CDS       T01002                                 

Gene name
Prkacb, CbPKA, Pkacb
Definition
(RefSeq) protein kinase, cAMP dependent, catalytic, beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu04742  Taste transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04910  Insulin signaling pathway
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing's syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04962  Vasopressin-regulated water reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04976  Bile secretion
mmu05012  Parkinson's disease
mmu05020  Prion diseases
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05032  Morphine addiction
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Module
mmu_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    18749 (Prkacb)
   04010 MAPK signaling pathway
    18749 (Prkacb)
   04310 Wnt signaling pathway
    18749 (Prkacb)
   04340 Hedgehog signaling pathway
    18749 (Prkacb)
   04371 Apelin signaling pathway
    18749 (Prkacb)
   04020 Calcium signaling pathway
    18749 (Prkacb)
   04024 cAMP signaling pathway
    18749 (Prkacb)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    18749 (Prkacb)
  Cell growth and death
   04114 Oocyte meiosis
    18749 (Prkacb)
  Cellular community - eukaryotes
   04530 Tight junction
    18749 (Prkacb)
   04540 Gap junction
    18749 (Prkacb)
 Organismal Systems
  Immune system
   04611 Platelet activation
    18749 (Prkacb)
   04062 Chemokine signaling pathway
    18749 (Prkacb)
  Endocrine system
   04911 Insulin secretion
    18749 (Prkacb)
   04910 Insulin signaling pathway
    18749 (Prkacb)
   04922 Glucagon signaling pathway
    18749 (Prkacb)
   04923 Regulation of lipolysis in adipocyte
    18749 (Prkacb)
   04912 GnRH signaling pathway
    18749 (Prkacb)
   04913 Ovarian Steroidogenesis
    18749 (Prkacb)
   04915 Estrogen signaling pathway
    18749 (Prkacb)
   04914 Progesterone-mediated oocyte maturation
    18749 (Prkacb)
   04921 Oxytocin signaling pathway
    18749 (Prkacb)
   04926 Relaxin signaling pathway
    18749 (Prkacb)
   04918 Thyroid hormone synthesis
    18749 (Prkacb)
   04919 Thyroid hormone signaling pathway
    18749 (Prkacb)
   04928 Parathyroid hormone synthesis, secretion and action
    18749 (Prkacb)
   04916 Melanogenesis
    18749 (Prkacb)
   04924 Renin secretion
    18749 (Prkacb)
   04925 Aldosterone synthesis and secretion
    18749 (Prkacb)
   04927 Cortisol synthesis and secretion
    18749 (Prkacb)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    18749 (Prkacb)
   04270 Vascular smooth muscle contraction
    18749 (Prkacb)
  Digestive system
   04970 Salivary secretion
    18749 (Prkacb)
   04971 Gastric acid secretion
    18749 (Prkacb)
   04976 Bile secretion
    18749 (Prkacb)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    18749 (Prkacb)
   04961 Endocrine and other factor-regulated calcium reabsorption
    18749 (Prkacb)
  Nervous system
   04724 Glutamatergic synapse
    18749 (Prkacb)
   04727 GABAergic synapse
    18749 (Prkacb)
   04725 Cholinergic synapse
    18749 (Prkacb)
   04728 Dopaminergic synapse
    18749 (Prkacb)
   04726 Serotonergic synapse
    18749 (Prkacb)
   04720 Long-term potentiation
    18749 (Prkacb)
   04723 Retrograde endocannabinoid signaling
    18749 (Prkacb)
  Sensory system
   04740 Olfactory transduction
    18749 (Prkacb)
   04742 Taste transduction
    18749 (Prkacb)
   04750 Inflammatory mediator regulation of TRP channels
    18749 (Prkacb)
  Aging
   04211 Longevity regulating pathway - mammal
    18749 (Prkacb)
   04213 Longevity regulating pathway - multiple species
    18749 (Prkacb)
  Environmental adaptation
   04713 Circadian entrainment
    18749 (Prkacb)
   04714 Thermogenesis
    18749 (Prkacb)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    18749 (Prkacb)
   05205 Proteoglycans in cancer
    18749 (Prkacb)
   05203 Viral carcinogenesis
    18749 (Prkacb)
  Neurodegenerative diseases
   05012 Parkinson's disease
    18749 (Prkacb)
   05020 Prion diseases
    18749 (Prkacb)
  Substance dependence
   05030 Cocaine addiction
    18749 (Prkacb)
   05031 Amphetamine addiction
    18749 (Prkacb)
   05032 Morphine addiction
    18749 (Prkacb)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    18749 (Prkacb)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    18749 (Prkacb)
  Infectious diseases
   05166 HTLV-I infection
    18749 (Prkacb)
   05169 Epstein-Barr virus infection
    18749 (Prkacb)
   05165 Human papillomavirus infection
    18749 (Prkacb)
   05146 Amoebiasis
    18749 (Prkacb)
  Drug resistance
   01522 Endocrine resistance
    18749 (Prkacb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     18749 (Prkacb)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKA family
   18749 (Prkacb)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     18749 (Prkacb)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    18749 (Prkacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 18749
NCBI-ProteinID: NP_035230
MGI: 97594
Ensembl: ENSMUSG00000005034
Vega: OTTMUSG00000016475
UniProt: P68181
Position
3; 3 H2
AA seq 351 aa AA seqDB search
MGNTAIAKKGSEVESVKEFLAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKCGKEFCEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggggaacactgcgatcgccaagaaaggcagcgaagtggagagcgtgaaagagtttcta
gccaaagccaaagaagactttctgaggaaatgggagaaccctcccccgagtaatgctggg
cttgaggattttgagaggaagaaaaccctcgggacgggttcctttggaagagtcatgttg
gtgaagcataaagccactgagcagtactacgccatgaagatcttagacaagcagaaggtt
gttaagctgaagcaaatagagcacactctgaatgagaagagaatcctgcaggccgtggag
ttcccgttccttgtgcggctggagtactcttttaaggataattctaatttatacatggtt
atggaatacgtccctgggggagagatgttctcacatctgagaagaattggaaggttcagt
gagccccacgcccgtttctatgcagcccagattgtgctaacatttgagtaccttcattcc
ctcgacctcatctacagagatctcaagccggaaaacctcttaattgaccaccagggttac
atccaggtcacagatttcgggttcgccaaaagagtcaagggcaggacatggacattgtgt
ggcaccccagagtacctggccccggagatcatcctcagcaagggttacaataaggcggtg
gactggtgggcactgggcgtgctgatctatgagatggctgctggctaccctccattcttt
gctgaccagccaattcagatctatgagaagattgtctctggaaaggtccggttcccatca
cacttcagctccgatctcaaggaccttctgcggaacctgctgcaggtggatctgacaaag
cgattcgggaacctgaagaacggcgtgagtgacataaagacccacaagtggtttgccaca
actgactggattgctatttatcagagaaaggttgaggctccattcataccaaagttcaga
ggctctggcgataccagcaacttcgatgactatgaagaagaagaaatccgtgtgtctata
acagaaaaatgtggaaaggaattttgtgaattttag

DBGET integrated database retrieval system