KEGG   Mus musculus (mouse): 18753Help
Entry
18753             CDS       T01002                                 

Gene name
Prkcd, AI385711, D14Ertd420e, PKC[d], PKCdelta, Pkcd
Definition
(RefSeq) protein kinase C, delta (EC:2.7.10.2 2.7.11.13)
  KO
K06068  
novel protein kinase C delta type [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
Chemokine signaling pathway
Vascular smooth muscle contraction
Tight junction
Fc gamma R-mediated phagocytosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Estrogen signaling pathway
Type II diabetes mellitus
Insulin resistance
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    18753 (Prkcd)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    18753 (Prkcd)
   04062 Chemokine signaling pathway
    18753 (Prkcd)
  Endocrine system
   04912 GnRH signaling pathway
    18753 (Prkcd)
   04915 Estrogen signaling pathway
    18753 (Prkcd)
  Circulatory system
   04270 Vascular smooth muscle contraction
    18753 (Prkcd)
  Nervous system
   04722 Neurotrophin signaling pathway
    18753 (Prkcd)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18753 (Prkcd)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    18753 (Prkcd)
   04931 Insulin resistance
    18753 (Prkcd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18753 (Prkcd)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     18753 (Prkcd)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   18753 (Prkcd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14 B; 14 18.82 cM
AA seq 674 aa AA seqDB search
MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTFD
AHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQY
FLEDGDCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSR
KLDTTESVGIYQGFEKKPEVSGSDILDNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGK
VLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDH
LFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLD
RDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEML
IGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVTGNIRIHPF
FKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHG
FSFVNPKFEQFLDI
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcacccttcctgcgcatctccttcaattcctatgagctgggctccctgcaagttgag
gacgaagcaagccagcctttctgtgctgtgaagatgaaggaggcactcagcacagagcga
gggaagacactggtacagaagaagcccaccatgtatcctgagtggaagacaacgttcgac
gcccacatctatgaaggccgtgttatccagattgtgctgatgcgggcagctgaagacccc
gtgtctgaggtcacggtgggcgtgtcagtactggctgagcgctgcaagaagaacaacggc
aaggctgagttctggctggatctgcagcctcaggccaaggtgctgatgtgtgtgcagtat
ttcctggaggatggggattgcaaacagtctatgcgtagtgaggaggaggcaaagtttcca
accatgaaccgtcgtggagccattaaacaggccaagatccactacatcaagaaccacgag
tttatcgccaccttcttcgggcagcccaccttctgttctgtgtgcaaagagtttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgcaacgctgccatccacaagaaatgc
attgacaagattatcggccgctgcactggcactgccaccaatagccgggacaccatcttc
cagaaagaacgcttcaacatcgacatgcctcaccgattcaaggtttataactacatgagc
cccaccttctgtgaccactgtggcagtttgctctggggactggtgaagcagggattaaag
tgtgaagattgtggcatgaatgtgcaccacaaatgccgggagaaggtggccaacctgtgt
ggtatcaaccaaaagctcttggctgaggccttgaaccaagtgacccagagatcttcccgg
aagctggacacaacagagtctgtcggaatataccagggatttgagaagaagccagaagtc
tctgggagtgacatcctagacaacaacgggacctatggcaagatctgggaggggagcacc
cggtgcacccttgagaacttcaccttccaaaaagtacttggcaaaggcagctttggcaag
gtgctgctggcagagctgaagggcaaagacaagtactttgcaatcaagtgtctgaagaag
gacgtggtgttgattgacgatgatgtagagtgtaccatggtggagaagcgggtgctggcg
ctcgcctgggagagtcccttcctcacccacctcatctgtaccttccagaccaaggaccac
ctgttcttcgtgatggagtttctcaatgggggtgacctgatgttccacattcaggacaaa
ggccgcttcgaactctaccgggctacgttttatgcagctgagatcatctgcggactgcag
tttctacacagcaaaggcattatttacagggacctcaagctggacaatgtgatgctagac
agggacggccacatcaagatcgctgactttgggatgtgcaaagagaatatatttggggag
ggccgggccagcacattctgcggcactcctgactacatcgcccctgagatcctgcagggc
ctgaagtactccttctcggtggactggtggtctttcggggtcctcctgtacgaaatgctc
atcggccagtcccccttccacggcgacgatgaggacgagctcttcgagtccatccgggtg
gacacaccacactatccccgttggatcaccaaggaatccaaggacatcatggagaagcta
ttcgagagggaccctgacaagaggctgggagtaacaggaaacatcaggattcaccccttt
ttcaagactatcaactggtccctcctggagaagcggaaggtggagccgccctttaagccc
aaagtgaaatccccttcagactacagcaactttgacccagagttcctgaatgagaaacct
cagctttccttcagtgacaagaacctcatcgactctatggaccaggaagccttccatggc
ttctcctttgtgaatcccaagtttgagcaattcctggacatttaa

DBGET integrated database retrieval system