KEGG   Mus musculus (mouse): 18764Help
Entry
18764             CDS       T01002                                 

Gene name
Pkd2, C030034P18Rik, PC2, TRPP2
Definition
(RefSeq) polycystic kidney disease 2
  KO
K04986  
polycystin 2
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     18764 (Pkd2)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPP (Polycystin)
   18764 (Pkd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 E5; 5 50.68 cM
AA seq 966 aa AA seqDB search
MVNSRRVQPQPPGDAGRSPAPRASGPGRLVAGGAGLAVPGGLGEQRGLEIEMERIRQAAA
RDPPAGASASPSPPLSSCSRQAWSRDNPGFEAEEDDDDDEVEGEEGGMVVEMDVEWRPGS
RRSASSSAVSSVGARGRGLGSYRGAAHLSGRRRRLEDQGAQCPSPAGGGDPLHRHLPLEG
QPPRVAWAERLVRGLRGLWGTRLMEESNANREKYLKSVLRELVTYLFFLVVLCILTYGMM
SSNVYYYTRTLSQLFIDTPVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNHTQ
ADNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRN
GTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAA
FIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLIRYVTAFDFFLAACEIIFCF
FIIYYVVEEILEIRIHRLSYFRSFWNCLDVVIVVLSVVAMVINIYRMSNAEGLLQFLEDQ
NSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTI
MFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFT
TFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTV
DAISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDL
EKEREDLDLEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVL
VRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDARLGRDSEIHR
EQMERLVREELERWESDDAASQTGHGVSTQVGLGGQPHPRNPRPPSSQSAEGLEGGGGNG
SANVHA
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggttaactccagacgcgtgcagccgcagccgcccggggacgcgggacgctcgcccgcg
ccgcgagcgtccggacccgggcgcctggtggcgggaggcgccggcctagctgtccccggc
ggcctcggggagcagcggggcctggagatcgagatggagcgcatccggcaggcggccgct
cgggatcccccggccggagcctcggcctcgccgtctcctccgctttcgtcctgctccagg
caagcgtggagccgcgacaacccgggctttgaggcagaggaggatgacgacgacgacgag
gtggaaggagaagaaggagggatggtggtagagatggatgtggagtggcgcccgggcagt
cggaggtcggcctcctcctcggccgtgagctcggtgggcgcccgcggccgagggctcggg
agctaccgcggcgcggctcacctgagcgggaggcggcgccggctagaggaccagggcgcg
cagtgtcccagccccgcgggcggcggggacccgctgcatcgccacctcccgctggagggc
cagccaccccgagtggcctgggcagagaggctggtgcgagggctgcgaggtctctgggga
acaagactcatggaagagagcaacgccaaccgagagaagtacctgaaaagtgtgttacgg
gagctggtcacttacctctttttcctcgtagtcttgtgcatcttgacctacggcatgatg
agctccaatgtgtactactacactcggacactgtcacagctattcatagacaccccagtg
tcgaaaacagagaaaaccaactttaaaactctttcttccatggaggacttctggaagttc
accgaaggctccttcctggatgggctgtactggaaggcacagaccagcaaccacacgcaa
gctgacaaccgaagctttatcttctatgagaacctgctgctaggagtgccgcgtctacgc
caactccgagtcagaaacggatcctgctccatccctcaggacctgcgagatgaaattaaa
gagtgctatgacgtctactccgtcagcagtgaggacagagctccatttggaccgcggaat
ggaactgcgtggatgtacacaagtgagaaggagctgaatgggagcagtcactgggggatc
attgcgtcgtacagtggagcgggttactacctggatctgtccagaaccagggaggagaca
gcagcccagcttgctggcctcaggaggaacttctggctggaccggggcacgcgggcagct
tttatagacttctcggtgtataacgcaaacattaacctgttctgtgtggtcaggttattg
gcggagttcccagcaacgggtggcgtggtaccctcttggcagtttcagcctgtaaaactg
atccgctatgtcacagcctttgatttcttcctggcagcctgtgagatcatcttttgtttc
tttatcatttactatgtggtggaagagatattggaaattcggattcacagactgagctat
ttcaggagtttctggaattgtctggatgttgtgattgtcgtgttatctgtagtagctatg
gtgattaacatttaccgaatgtcaaatgcagaggggctgctacagtttcttgaagatcaa
aattctttccccaactttgagcatgtggcatactggcaaatacagttcaacaatataagt
gctgtcatggtatttttggtctggattaagctcttcaaattcatcaattttaataggacc
atgagccagctctccacaaccatgtctcgatgtgccaaagacctcttcggcttcaccata
atgttctccatcatcttcttggcatacgcacagctggcataccttgtcttcggcacccag
gtcgatgacttcagcactttccaagaatgtatcttcacccagttccgcatcattttgggt
gatatcaacttcgcagagatcgaggaagctaaccgagttttggggccactttattttact
acatttgtgttctttatgttcttcattcttttgaatatgttcctggcgatcatcaatgat
tcgtactctgaagtgaaatccgatctggcccagcagaaagcagaaatggaactctcagac
cttatcagaaagggctgccaaaaagcactggtcaaactaaaactgaaaagaaacactgta
gatgccatctcagagagtctccggcaaggtggtggcaaactgaactttgatgagcttcgg
caagacctgaaagggaagggccatacagatgcagagattgaggccatattcactaaatat
gaccaggatggcgaccaggaactgaccgagcgtgagcatcaacagatgagagatgacttg
gagaaagagagggaggacctagacttggaacacagctctttaccacgtccgatgagcagc
agaagtttccccagaagcctggatgactccgaggaggaggatgacgaagacagtggccat
agctccaggaggaggggaagcatctccagtggggtttcctatgaagagttccaagtactg
gtgaggcgcgtggaccgcatggagcactccattggcagcatcgtttccaagattgatgcc
gtgattgtcaagctggagatcatggagcgggccaagctgaagagacgagaggtgttagga
cggctgctggatggcgtggctgaggatgcgcgactgggtcgggacagtgagatccacagg
gagcagatggagcgcctggtgcgggaagagctggagcgctgggaatcggatgatgcagct
tcgcaaacaggtcatggtgtaagcacacaagtgggactcggtggccagccccaccccaga
aacccgcgccctccttcctcccagtctgcagagggcctggaaggtggaggtggaaatgga
agtgccaacgtccatgcctaa

DBGET integrated database retrieval system