KEGG   Mus musculus (mouse): 18771Help
Entry
18771             CDS       T01002                                 

Gene name
Pknox1, D17Wsu76e, PREP1
Definition
Pbx/knotted 1 homeobox
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B-C; 17 16.78 cM
AA seq 436 aa AA seqDB search
MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSDPDAEGVSPPPIESQTPMDADKQAIYR
HPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKDGKPFFCEDPETDNLMVK
AIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAI
TGTLSPQGIVVPASALQQGNVTMATVAGGTVYQPVTVVTPQGQVVTQALSPGTIRIQNSQ
LQLQLNQDLSILHQEDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTN
LTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKPAQNRPVQRFWPDSLASGVAQATPS
ELAMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEDEGGALA
PTHISGLVLENSDSLQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgacacagacgctaagtatagacagctatcaagatggacagcaaatgcaggtg
gtcacggagttaaaaacagagcaagatcccaactgctctgacccagatgcagaaggagtg
agtcctcctcccatcgagtctcagaccccaatggatgccgacaagcaggccatttatagg
catccactatttccgttgctagctttgttgtttgagaagtgtgagcagtccacacagggc
tcagaaggcacgacgtctgccagcttcgatgtggacattgagaactttgtcaggaagcaa
gaaaaggatgggaaacccttcttctgtgaagatccggaaactgacaacctaatggtgaaa
gcaatccaggtcctgcgcattcatcttcttgaactggagaaggttaatgagctctgtaaa
gatttctgtagtcggtacattgcttgtctgaagacaaaaatgaacagcgagaccttgttg
agtggggagcctggaagtccgtactcccctgtgcaatcccagcagattcagagtgccatc
acaggcacgctcagcccccagggaatcgtggtgccagcatcagccctacaacagggaaat
gtaaccatggcaacagtggcaggtggcacagtgtaccagcctgtcaccgtcgtcactccg
caaggccaagtggtcacgcaggcattatctcctgggacaattaggatccagaactcacag
ctgcagttgcagttgaaccaagacctcagcatcttgcatcaagaggatggctcctccaag
aacaagaggggtgtcctgccgaagcacgccaccaacgtgatgcggtcctggctctttcag
cacatagggcatccctacccaacagaggatgagaaaaagcagattgctgctcagacgaat
ctgaccctgcttcaagtcaacaactggttcatcaacgcgagaagacgaattctccagcca
atgttggattccagctgctcagagactccaaaaacgaagaaaaaacctgctcagaacagg
ccagttcagaggttttggccagattctcttgcatcaggagtggcacaagcaacacccagc
gagcttgccatgtcagaaggtgccgttgtgaccatcaccacacctgtaaacatgaatgtg
gacagccttcagtccctgtcctcagacggggccaccctggccgtacagcaggtcatgatg
gcagggcagagtgaggacgagtcggtggatagcacagaggatgagggcggcgccctggcg
cccacacacatcagcgggctggtgctggagaacagcgactcccttcagtag

DBGET integrated database retrieval system