KEGG   Mus musculus (mouse): 18777Help
Entry
18777             CDS       T01002                                 

Gene name
Lypla1, Pla1a
Definition
lysophospholipase 1 (EC:3.1.1.5)
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    18777 (Lypla1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     18777 (Lypla1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 A1; 1
AA seq 230 aa AA seqDB search
MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMP
VTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLM
FGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaacaacatgtccgctccgatgcccgccgttgtgccggccgcccggaaggcc
accgccgcggttattttccttcacggattgggagatacagggcatggatgggcagaagcc
tttgcaggtatcaaaagtccccacatcaaatacatctgtccacatgcccctgtgatgcca
gtcacattaaatatgaatatggctatgccttcttggtttgatatcgttggactttcacca
gattcccaggaagatgaatctggaattaaacaggcagcagaaaccgtaaaagccttgata
gatcaagaagtgaagaatggcattccttctaacaggattattttgggaggattttctcag
ggaggcgccttgtctttatacactgctctcaccacacagcagaaactggctggtgtcact
gcactcagttgctggcttccacttcgggcttcgttttcacaggggccgatcaacagtgct
aatcgagatatttccgttctccagtgccatggagattgtgaccctttagttcccctaatg
tttggttctcttactgttgaaagactaaaagcattgataaatccagccaatgtaaccttc
aaaatctatgaaggcatgatgcacagctcatgtcagcaggaaatgatggatgtcaagcac
ttcattgataagctcctacctccaattgattga

DBGET integrated database retrieval system