KEGG   Mus musculus (mouse): 18791Help
Entry
18791             CDS       T01002                                 

Gene name
Plat, AU020998, AW212668, D8Ertd2e, tPA
Definition
(RefSeq) plasminogen activator, tissue (EC:3.4.21.68)
  KO
K01343  
tissue plasminogen activator [EC:3.4.21.68]
Organism
mmu  Mus musculus (mouse)
Pathway
Complement and coagulation cascades
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    18791 (Plat)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    18791 (Plat)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     18791 (Plat)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   18791 (Plat)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
   18791 (Plat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 A2; 8 11.42 cM
AA seq 559 aa AA seqDB search
MKRELLCVLLLCGLAFPLPDQGIHGRFRRGARSYRATCRDEPTQTTYQQHQSWLRPMLRS
SRVEYCRCNSGLVQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDT
RATCFEEQGITYRGTWSTAESGAECINWNSSVLSLKPYNARRPNAIKLGLGNHNYCRNPD
RDLKPWCYVFKAGKYTTEFCSTPACPKGKSEDCYVGKGVTYRGTHSLTTSQASCLPWNSI
VLMGKSYTAWRTNSQALGLGRHNYCRNPDGDARPWCHVMKDRKLTWEYCDMSPCSTCGLR
QYKRPQFRIKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFLER
FPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQE
SSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLF
NKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVP
GVYTKVTNYLDWIHDNMKQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagagctgctgtgtgtactgctgctttgtggactggctttcccattgcctgac
cagggaatacatgggaggttcagaagaggagcccggtcctacagagcgacctgcagagat
gagccaacgcagacaacttaccaacagcaccagtcgtggctccgacccatgctcagaagc
agccgggtggaatattgccggtgcaacagcggcctggtacaatgccactcagtgcctgtc
cgaagttgcagcgaaccaagatgcttcaatggggggacgtgtcagcaggccctgtatttc
tctgactttgtctgccagtgccctgatggatttgtagggaaacgctgtgacatagatacc
agagcaacatgctttgaggagcagggcatcacctacagaggcacgtggagcacagcagaa
agtggggctgagtgcatcaactggaatagcagtgttctgtcgctgaagccctacaatgca
aggaggccaaatgccatcaagctgggccttgggaatcacaattactgcagaaacccagac
cgagacttgaagccctggtgctatgtctttaaggcagggaagtataccacggagttctgt
agcacaccagcttgccctaagggaaaaagcgaggactgctatgttgggaaaggtgtgact
taccgtggcacccacagcctcaccacatcccaggcctcctgcctcccctggaattccata
gtcctcatgggcaagagttacacagcgtggaggaccaactcccaggcactcggcctgggc
agacacaattattgtcggaatccagatggtgatgccagaccttggtgccatgtgatgaag
gaccgaaagctgacgtgggaatactgtgacatgtccccatgctccacctgtggcctgagg
cagtacaaacggcctcagtttagaattaaaggaggactctacacagacatcacctcacac
ccttggcaggctgccatctttgtcaagaacaagaggtctcctggagagagattcctttgt
ggaggggtgctgatcagttcctgctgggtgctgtcagctgcccactgctttctagagagg
ttcccccccaatcatcttaaagtggtcttgggcagaacatacagggtggtccccggagag
gaagaacagacatttgagattgaaaaatacatagtccatgaggaatttgatgacgatact
tatgacaacgacatcgcattactgcagctgaggtcacagtccaagcaatgtgcccaagag
agcagctctgttggcactgcctgcctccctgaccccaacctgcagctccctgactggaca
gagtgtgagctttctggctacggcaagcatgaggcatcgtctccattcttctctgaccgg
ctgaaggaggctcacgtcagactgtacccgtccagccgctgcacctcacagcatctgttt
aataaaaccgtcacgaacaacatgctgtgcgctggagacacccggagcggaggcaaccaa
gacctccacgatgcatgccagggtgactcgggaggccctctggtgtgcatgatcaataaa
cagatgacattgactggcattatcagctggggcctcggctgtgggcagaaggatgtgcct
ggggtctacacaaaggttacgaattacctagactggattcacgacaacatgaagcaatga

DBGET integrated database retrieval system