KEGG   Mus musculus (mouse): 18791Help
Entry
18791             CDS       T01002                                 

Gene name
Plat, AU020998, AW212668, D8Ertd2e, tPA
Definition
(RefSeq) plasminogen activator, tissue
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04371  Apelin signaling pathway
mmu04610  Complement and coagulation cascades
mmu05202  Transcriptional misregulation in cancer
mmu05215  Prostate cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    18791 (Plat)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    18791 (Plat)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    18791 (Plat)
   05215 Prostate cancer
    18791 (Plat)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    18791 (Plat)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     18791 (Plat)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   18791 (Plat)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
   18791 (Plat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle fn1 EGF DUF1986 Trypsin_2 hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 18791
NCBI-ProteinID: NP_032898
MGI: 97610
Ensembl: ENSMUSG00000031538
Vega: OTTMUSG00000060895
UniProt: P11214
Position
8 A2; 8 11.42 cM
AA seq 559 aa AA seqDB search
MKRELLCVLLLCGLAFPLPDQGIHGRFRRGARSYRATCRDEPTQTTYQQHQSWLRPMLRS
SRVEYCRCNSGLVQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDT
RATCFEEQGITYRGTWSTAESGAECINWNSSVLSLKPYNARRPNAIKLGLGNHNYCRNPD
RDLKPWCYVFKAGKYTTEFCSTPACPKGKSEDCYVGKGVTYRGTHSLTTSQASCLPWNSI
VLMGKSYTAWRTNSQALGLGRHNYCRNPDGDARPWCHVMKDRKLTWEYCDMSPCSTCGLR
QYKRPQFRIKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFLER
FPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQE
SSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLF
NKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVP
GVYTKVTNYLDWIHDNMKQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagagctgctgtgtgtactgctgctttgtggactggctttcccattgcctgac
cagggaatacatgggaggttcagaagaggagcccggtcctacagagcgacctgcagagat
gagccaacgcagacaacttaccaacagcaccagtcgtggctccgacccatgctcagaagc
agccgggtggaatattgccggtgcaacagcggcctggtacaatgccactcagtgcctgtc
cgaagttgcagcgaaccaagatgcttcaatggggggacgtgtcagcaggccctgtatttc
tctgactttgtctgccagtgccctgatggatttgtagggaaacgctgtgacatagatacc
agagcaacatgctttgaggagcagggcatcacctacagaggcacgtggagcacagcagaa
agtggggctgagtgcatcaactggaatagcagtgttctgtcgctgaagccctacaatgca
aggaggccaaatgccatcaagctgggccttgggaatcacaattactgcagaaacccagac
cgagacttgaagccctggtgctatgtctttaaggcagggaagtataccacggagttctgt
agcacaccagcttgccctaagggaaaaagcgaggactgctatgttgggaaaggtgtgact
taccgtggcacccacagcctcaccacatcccaggcctcctgcctcccctggaattccata
gtcctcatgggcaagagttacacagcgtggaggaccaactcccaggcactcggcctgggc
agacacaattattgtcggaatccagatggtgatgccagaccttggtgccatgtgatgaag
gaccgaaagctgacgtgggaatactgtgacatgtccccatgctccacctgtggcctgagg
cagtacaaacggcctcagtttagaattaaaggaggactctacacagacatcacctcacac
ccttggcaggctgccatctttgtcaagaacaagaggtctcctggagagagattcctttgt
ggaggggtgctgatcagttcctgctgggtgctgtcagctgcccactgctttctagagagg
ttcccccccaatcatcttaaagtggtcttgggcagaacatacagggtggtccccggagag
gaagaacagacatttgagattgaaaaatacatagtccatgaggaatttgatgacgatact
tatgacaacgacatcgcattactgcagctgaggtcacagtccaagcaatgtgcccaagag
agcagctctgttggcactgcctgcctccctgaccccaacctgcagctccctgactggaca
gagtgtgagctttctggctacggcaagcatgaggcatcgtctccattcttctctgaccgg
ctgaaggaggctcacgtcagactgtacccgtccagccgctgcacctcacagcatctgttt
aataaaaccgtcacgaacaacatgctgtgcgctggagacacccggagcggaggcaaccaa
gacctccacgatgcatgccagggtgactcgggaggccctctggtgtgcatgatcaataaa
cagatgacattgactggcattatcagctggggcctcggctgtgggcagaaggatgtgcct
ggggtctacacaaaggttacgaattacctagactggattcacgacaacatgaagcaatga

DBGET integrated database retrieval system