KEGG   Mus musculus (mouse): 18792Help
Entry
18792             CDS       T01002                                 

Gene name
Plau, u-PA, uPA
Definition
(RefSeq) plasminogen activator, urokinase
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04610  Complement and coagulation cascades
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    18792 (Plau)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    18792 (Plau)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    18792 (Plau)
   05206 MicroRNAs in cancer
    18792 (Plau)
   05205 Proteoglycans in cancer
    18792 (Plau)
   05215 Prostate cancer
    18792 (Plau)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     18792 (Plau)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   18792 (Plau)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
   18792 (Plau)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle DUF316 Prokineticin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 18792
NCBI-ProteinID: NP_032899
MGI: 97611
Ensembl: ENSMUSG00000021822
UniProt: P06869 Q0VBA8
Structure
PDB: 

Jmol
Position
14 A3; 14 11.53 cM
AA seq 433 aa AA seqDB search
MKVWLASLFLCALVVKNSEGGSVLGAPDESNCGCQNGGVCVSYKYFSRIRRCSCPRKFQG
EHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKH
NYCRNPDNQKRPWCYVQIGLRQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKI
VGGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVY
LGQSKESSYNPGEMKFEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTI
CLPPRFTDAPFGSDCEITGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYK
MLCAADPEWKTDSCKGDSGGPLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDW
IQSHIGEEKGLAF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctggctggcgagcctgttcctctgcgccttggtggtgaaaaactctgaaggt
ggcagtgtacttggagctcctgatgaatcaaactgtggctgtcagaacggaggtgtatgc
gtgtcctacaagtacttctccagaattcgccgatgcagctgcccaaggaaattccagggg
gagcactgtgagatagatgcatcaaaaacctgctatcatggaaatggtgactcttaccga
ggaaaggccaacactgataccaaaggtcggccctgcctggcctggaatgcgcctgctgtc
cttcagaaaccctacaatgcccacagacctgatgctattagcctaggcctggggaaacac
aattactgcaggaaccctgacaaccagaagcgaccctggtgctatgtgcagattggccta
aggcagtttgtccaagaatgcatggtgcatgactgctctcttagcaaaaagccttcttcg
tctgtagaccaacaaggcttccagtgtggccagaaggctctaaggccccgctttaagatt
gttgggggagaattcactgaggtggagaaccagccctggttcgcagccatctaccagaag
aacaagggaggaagtcctccctcctttaaatgtggtgggagtctcatcagtccttgctgg
gtggccagtgccgcacactgcttcattcaactcccaaagaaggaaaactacgttgtctac
ctgggtcagtcgaaggagagctcctataatcctggagagatgaagtttgaggtggagcag
ctcatcttgcacgaatactacagggaagacagcctggcctaccataatgatattgccttg
ctgaagatacgtaccagcacgggccaatgtgcacagccatccaggtccatacagaccatc
tgcctgcccccaaggtttactgatgctccgtttggttcagactgtgagatcactggcttt
ggaaaagagtctgaaagtgactatctctatccaaagaacctgaaaatgtccgtcgtaaag
cttgtttctcatgaacagtgtatgcagccccactactatggctctgaaattaattataaa
atgctgtgtgctgcggacccagagtggaaaacagattcctgcaagggcgattctggagga
ccgcttatctgtaacatcgaaggccgcccaactctgagtgggattgtgagctggggccga
ggatgtgcagagaaaaacaagcccggtgtctacacgagggtctcacacttcctggactgg
attcaatcccacattggagaagagaaaggtctggccttctga

DBGET integrated database retrieval system