KEGG   Mus musculus (mouse): 18813Help
Entry
18813             CDS       T01002                                 

Gene name
Pa2g4, 38kDa, AA672939, Ebp1, Plfap
Definition
(RefSeq) proliferation-associated 2G4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10; 10 D3
AA seq 394 aa AA seqDB search
MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEET
GKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIAN
VAHTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCT
PIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDA
GQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHE
LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQS
SASRKTQKKKKKKASKTVENATSGETLEENGAGD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgaagacgagcagcaggagcaaactatcgccgaggacctggtcgtgaccaag
tataagatggggggcgacatcgccaaccgggtgcttcgatctttggtggaggcttccagc
tcaggtgtgtctgtgctgagcttgtgtgagaaaggtgatgccatgattatggaagagaca
gggaagatcttcaagaaggaaaaggagatgaagaaaggtattgcctttcctaccagcatt
tccgtaaataactgtgtgtgtcacttctcccctttgaagagtgaccaggactatatactc
aaggaaggtgacttggtaaaaattgaccttggggttcatgtggatggcttcattgccaat
gtggctcacacttttgtaattggtgtagctcaggggacccaggtaacagggcggaaagca
gatgtcattaaggccgctcacctatgtgctgaagctgccttacgactggtcaaacctgga
aaccagaacacacaagtgactgaagcatggaacaaggttgctcactcatttaactgcaca
ccaatagaaggtatgctgtcacaccaattgaagcagcatgtgattgatggagagaagacg
attatccagaaccctacagaccagcagaagaaggaccatgaaaaggcagaatttgaggtg
catgaggtttatgctgtagatgtcctcgtcagctcaggagaaggcaaggccaaagatgca
ggacagagaaccaccatctacaagcgagacccctctaaacaatatggcctgaaaatgaaa
acttcacgtgcctttttcagtgaggtggaacggcgttttgatgccatgccgtttacttta
agagcatttgaagatgagaagaaggctcgaatgggtgtggtagagtgtgccaaacatgag
ttactacagccatttaacgttctctatgagaaggagggtgaatttgttgcccagtttaaa
tttacagttctactcatgcccaacggccccatgcggataaccagtggtccctttgagcct
gacctgtacaagtctgagatggaggttcaagatgcagagctgaaggctcttctccagagt
tctgcaagtagaaaaacccagaaaaagaagaaaaagaaggcctccaagactgtagagaat
gccaccagtggagaaaccttagaagagaatggagctggggactga

DBGET integrated database retrieval system