KEGG   Mus musculus (mouse): 18984Help
Entry
18984             CDS       T01002                                 

Gene name
Por, 4933424M13Rik, CPR, CYPOR
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     18984 (Por)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5 75.34 cM
AA seq 678 aa AA seqDB search
MGDSHEDTSATVPEAVAEEVSLFSTTDIVLFSLIVGVLTYWFIFKKKKEEIPEFSKIQTT
APPVKESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLA
DLSSLPEIDKSLVVFCMATYGEGDPTDNAQDFYDWLQETDVDLTGVKFAVFGLGNKTYEH
FNAMGKYVDQRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEFFGVEATGEES
SIRQYELVVHEDMDTAKVYTGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHL
MHLELDISDSKIRYESGDHVAVYPANDSTLVNQIGEILGADLDVIMSLNNLDEESNKKHP
FPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEHLHKMASSSGEGKELYLSWV
VEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYEA
KSGRVNKGVATSWLRTKEPAGENGRRALVPMFVRKSQFRLPFKPTTPVIMVGPGTGVAPF
MGFIQERAWLREQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNVAFSREQA
HKVYVQHLLKRDKEHLWKLIHEGGAHIYVCGDARNMAKDVQNTFYDIVAEFGPMEHTQAV
DYVKKLMTKGRYSLDVWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgggggactctcacgaagacaccagtgccacagtgcctgaggcagtggctgaagaagtg
tctctattcagcacaacggacattgttctgttttctctcatcgtgggggtcctgacctac
tggttcatctttaaaaagaagaaagaagagataccggagttcagcaagatccagacaacg
gccccacctgtcaaagagagcagcttcgtggaaaagatgaagaaaacgggaaggaacatt
attgtattctatggctcccagacgggaaccgcggaggagtttgccaaccggctgtccaag
gatgcccaccgctatgggatgcggggcatgtctgcagaccctgaagagtatgacttggcc
gacctgagcagcctgcctgagatcgacaagtccctggtagtcttctgcatggccacatac
ggagaaggcgaccccaccgacaacgcgcaggacttctatgattggctgcaggagactgac
gtggacctcacgggtgtcaagtttgctgtgtttggtctcgggaacaagacctatgagcac
ttcaacgccatgggcaagtatgtggaccagcggctggagcagcttggcgcccagcgaatc
tttgagttgggccttggtgatgacgacgggaacttggaagaggatttcatcacatggagg
gagcagttctggccagctgtgtgcgagttcttcggggtggaagccactggggaggagtcg
agcatccgccagtacgagctcgtggtccacgaagacatggacacagccaaggtgtacacg
ggtgagatgggccgtctgaagagctacgagaaccagaaaccccccttcgatgccaagaat
ccattcctggctgctgtcaccacgaaccggaagctgaaccaaggcactgagaggcatcta
atgcacctggaattggacatctcagactccaagatcaggtatgaatctggagatcacgtg
gctgtgtacccagccaacgactccaccctggtcaaccagattggggagatcctgggggct
gacctggatgtcatcatgtctctaaacaatctcgatgaggagtcgaataagaagcatccg
ttcccctgccccaccacctaccgcacggccctcacctactacctggacatcactaacccg
ccacgaaccaacgtgctctacgagctggcccagtacgcctcagagccctcggagcaggaa
cacctgcacaagatggcgtcctcctccggcgagggcaaggagctgtacctgagctgggtg
gtggaggcccggaggcacatcctagccattctccaagactacccgtccctgcggccaccc
atcgaccacctgtgcgagctcctcccgaggctgcaggcccgctactattccattgcctcg
tcgtctaaggtccaccccaactccgtgcacatctgcgccgtggctgtggagtatgaagcg
aagtctggacgagtgaacaagggggtggccaccagctggcttcggaccaaggaaccagca
ggagagaatggccgccgggccctggtccccatgttcgtccgcaagtcccagttccgcttg
cctttcaagcccaccacacctgttatcatggtgggccccggcactggggttgcccctttc
atgggcttcatccaggagcgggcttggcttcgagagcaaggcaaggaggtcggagagacg
ctgctctactacggctgccggcgctcggatgaggactatctgtaccgcgaggagctggcg
cgcttccacaaggacggcgccctcacgcagcttaatgtggccttttcccgtgagcaggcc
cacaaggtctatgttcagcacctgctcaagagggacaaagagcacctgtggaagctgatc
cacgaaggtggtgcccacatctatgtctgcggggatgctcgaaatatggccaaagatgtg
cagaacacattctatgacatcgtggccgagtttgggcccatggagcacacccaggctgtg
gactatgttaagaagctcatgaccaagggccgctactcgctggatgtatggagctag

DBGET integrated database retrieval system