KEGG   Mus musculus (mouse): 19013Help
Entry
19013             CDS       T01002                                 

Gene name
Ppara, 4933429D07Rik, AW742785, Nr1c1, PPAR-alpha, PPARalpha, Ppar
Definition
peroxisome proliferator activated receptor alpha
Orthology
K07294  
peroxisome proliferator-activated receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mmu04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mmu03320]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:mmu04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:mmu05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
15 E2; 15 40.42 cM
AA seq 468 aa AA seqDB search
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtggacacagagagccccatctgtcctctctccccactggaggcagatgacctggaa
agtcccttatctgaagaattcttacaagaaatgggaaacattcaagagatttctcagtcc
atcggtgaggagagctctggaagctttggttttgcagactaccagtacttaggaagctgt
ccgggctccgagggctctgtcatcacagacaccctctctccagcttccagcccttcctca
gtcagctgccccgtgatccccgccagcacggacgagtcccccggcagtgccctgaacatc
gagtgtcgaatatgtggggacaaggcctcagggtaccactacggagttcacgcatgtgaa
ggctgtaagggcttctttcggcgaactattcggctgaagctggtgtacgacaagtgtgat
cggagctgcaagattcagaagaagaaccggaacaaatgccagtactgccgttttcacaag
tgcctgtctgtcgggatgtcacacaatgcaattcgctttggaagaatgccaagatctgaa
aaagcaaaactgaaagcagaaattcttacctgtgaacacgacctgaaagattcggaaact
gcagacctcaaatctctgggcaagagaatccacgaagcctacctgaagaacttcaacatg
aacaaggtcaaggcccgggtcatactcgcgggaaagaccagcaacaacccgccttttgtc
atacatgacatggagaccttgtgtatggccgagaagacgcttgtggccaagatggtggcc
aacggcgtcgaagacaaagaggcagaggtccgattcttccactgctgccagtgcatgtcc
gtggagaccgtcacggagctcacagaatttgccaaggctatcccaggctttgcaaacttg
gacttgaacgaccaagtcaccttgctaaagtacggtgtgtatgaagccatcttcacgatg
ctgtcctccttgatgaacaaagacgggatgctgatcgcgtacggcaatggctttatcaca
cgcgagttccttaagaacctgaggaagccgttctgtgacatcatggaacccaagtttgac
ttcgctatgaagttcaatgccttagaactggatgacagtgacatttccctgtttgtggct
gctataatttgctgtggagatcggcctggccttctaaacataggctacattgagaagttg
caggaggggattgtgcacgtgcttaagctccacctgcagagcaaccatccagatgacacc
ttcctcttcccaaagctccttcaaaaaatggtggaccttcggcagctggtcacggagcat
gcgcagctcgtacaggtcatcaagaagaccgagtccgacgcagcgctgcacccactgttg
caagagatctacagagacatgtactga

DBGET integrated database retrieval system