KEGG   Mus musculus (mouse): 19013Help
Entry
19013             CDS       T01002                                 

Gene name
Ppara, 4933429D07Rik, AW742785, Nr1c1, PPAR-alpha, PPARalpha, Ppar
Definition
peroxisome proliferator activated receptor alpha
Orthology
K07294  
peroxisome proliferator-activated receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
cAMP signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    19013 (Ppara)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    19013 (Ppara)
   03320 PPAR signaling pathway
    19013 (Ppara)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    19013 (Ppara)
  Infectious diseases
   05160 Hepatitis C
    19013 (Ppara)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    19013 (Ppara)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   19013 (Ppara)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
15 E2; 15 40.42 cM
AA seq 468 aa AA seqDB search
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtggacacagagagccccatctgtcctctctccccactggaggcagatgacctggaa
agtcccttatctgaagaattcttacaagaaatgggaaacattcaagagatttctcagtcc
atcggtgaggagagctctggaagctttggttttgcagactaccagtacttaggaagctgt
ccgggctccgagggctctgtcatcacagacaccctctctccagcttccagcccttcctca
gtcagctgccccgtgatccccgccagcacggacgagtcccccggcagtgccctgaacatc
gagtgtcgaatatgtggggacaaggcctcagggtaccactacggagttcacgcatgtgaa
ggctgtaagggcttctttcggcgaactattcggctgaagctggtgtacgacaagtgtgat
cggagctgcaagattcagaagaagaaccggaacaaatgccagtactgccgttttcacaag
tgcctgtctgtcgggatgtcacacaatgcaattcgctttggaagaatgccaagatctgaa
aaagcaaaactgaaagcagaaattcttacctgtgaacacgacctgaaagattcggaaact
gcagacctcaaatctctgggcaagagaatccacgaagcctacctgaagaacttcaacatg
aacaaggtcaaggcccgggtcatactcgcgggaaagaccagcaacaacccgccttttgtc
atacatgacatggagaccttgtgtatggccgagaagacgcttgtggccaagatggtggcc
aacggcgtcgaagacaaagaggcagaggtccgattcttccactgctgccagtgcatgtcc
gtggagaccgtcacggagctcacagaatttgccaaggctatcccaggctttgcaaacttg
gacttgaacgaccaagtcaccttgctaaagtacggtgtgtatgaagccatcttcacgatg
ctgtcctccttgatgaacaaagacgggatgctgatcgcgtacggcaatggctttatcaca
cgcgagttccttaagaacctgaggaagccgttctgtgacatcatggaacccaagtttgac
ttcgctatgaagttcaatgccttagaactggatgacagtgacatttccctgtttgtggct
gctataatttgctgtggagatcggcctggccttctaaacataggctacattgagaagttg
caggaggggattgtgcacgtgcttaagctccacctgcagagcaaccatccagatgacacc
ttcctcttcccaaagctccttcaaaaaatggtggaccttcggcagctggtcacggagcat
gcgcagctcgtacaggtcatcaagaagaccgagtccgacgcagcgctgcacccactgttg
caagagatctacagagacatgtactga

DBGET integrated database retrieval system