KEGG   Mus musculus (mouse): 19024Help
Entry
19024             CDS       T01002                                 

Gene name
Ppfibp2, Cclp1
Definition
(RefSeq) PTPRF interacting protein, binding protein 2 (liprin beta 2)
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SAM_1 SAM_2 DUF16 Reo_sigmaC FxsA PKcGMP_CC Alpha_kinase
Motif
Other DBs
NCBI-GeneID: 19024
NCBI-ProteinID: NP_032931
MGI: 894649
Ensembl: ENSMUSG00000036528
Vega: OTTMUSG00000059746
UniProt: O35711 G3X957
Position
7; 7 E3
AA seq 882 aa AA seqDB search
MTSDASHMLEAALEQMDGIIAGTKTAADFSDGTCEPGLSPPSTCLNSMPVLHLIEDLRLA
LEMLALPQEREALLSQVPGPTATYIKEWFEDSLSQVNHHGAASNETYQERLARLEGDKES
LILQVSVLTDQVEAQGEKIRDLEVCLEGHQVKLNAAEEMLQQELLSRTSLETQKLDLMTE
VSELKLKLVGMEKEQKEQEEKQRKAEELLQELKHLKIKVEELENERNQYEWELKATKAEV
AQLQEQVALKDAEIERLHSQLSRSAALHSDHAERDQEIHRLKMGMETLLVANEDKDRRIE
ELTGLLNKYLRVKEIVMATQGPSERTLSINEDEIEGSFRKWNTTNKSPEEVPKQEISPRC
SSPTPGPPPLPQKSLESRAQKKLSCSLEDLRRESGDKCVDGNQLSPVGEPKDSSFLAEQK
YPTLPGKLSGATPNGEAAKSPPTASLQPDSSGSSQPKLNRGWSVSAPVLGDTEGGWEDIV
SSASSGTESSPQSPVTPDGKRSPKGIKKFWGKIRRTQSGNFNTDAPGMAEFRRGGLRATA
GPRLSRTRDTKGQKCDANAPFAQWSTERVCTWMEDFGLGQYVIFARQWVTSGHTLLTATP
QDMEKELGIKHPLHRKKLVLAVKAINAKQEETSALLDHIWVTRWLDDIGLPQYKDQFHES
RVDGRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPNCLHRRPADESNLSPSE
VVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLIILEPRFTGDTLAMLLNIPPQKTLLR
RHLTTKFNALIGPEAEQEKRDKMASPAYTPLTTTAKVRPRKLGFSHFGNMRKKKFDESTD
YICPMEPGDAVSDSHRVYGVYRGLSPLDNHELDGLDQVGQIS
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgacgctagtcatatgctggaagctgccctggagcagatggacgggatcatt
gcaggcactaaaacagctgcagattttagtgatggtacctgtgagcctgggctgtctccc
ccatccacctgcttgaactccatgcctgtgctccatctcattgaggacctgagactagcc
ttggagatgttggcacttcctcaggaaagagaagccctcctgagccaggtccctggccca
acagctacctacataaaggagtggtttgaggacagcttgtcccaggtaaatcaccacggt
gctgctagtaatgaaacctaccaggaacgcctggcacggctagaaggagataaagagtcc
ctcatactacaggtgagcgtcctcacagatcaagtggaagcccaaggagagaagattcgg
gaccttgaagtgtgtctggaaggccaccaggtgaagctcaatgctgcagaagagatgctt
cagcaggagctgctaagtcgcacatctctggagacccagaagttggatctgatgactgag
gtgtctgagctgaagctcaagctggttggtatggaaaaagaacagaaagaacaagaagaa
aaacagagaaaagcagaggagttactgcaagagcttaagcacctcaaaatcaaggtggag
gagctggagaacgagcggaaccagtatgagtgggagctgaaggccaccaaggctgaggta
gcccagctgcaagaacaggtggccctaaaagatgcagaaattgagcgtctccacagccag
ctctcccggagtgcagctctccacagcgaccatgcagagcgagatcaagaaatccaccgt
ctgaaaatggggatggaaacactgctggttgccaatgaggataaggaccgtcggatagag
gagctgacagggctgttgaacaagtacctaagggtaaaggagattgtgatggcaactcag
gggccttcagaaagaaccctctccatcaatgaagatgaaatagagggaagcttccgaaaa
tggaataccacaaataaaagcccagaggaagtcccgaagcaagagatatcaccacgatgc
agctctcccaccccaggaccacctcctttgccacagaaatcactggagagcagggctcag
aagaaactctcctgcagtctagaagacttgagacgtgaatctggggataagtgtgtcgat
gggaaccagctgtccccagtgggagagcccaaggacagctctttcctagcggagcagaaa
taccccacattacctgggaagctttcaggagccacacccaatggagaagctgccaaatct
cctcccactgcctccctccagcctgactcttcagggagcagccagccaaagctgaatcgc
ggctggagtgtcagtgctcccgtattaggagacacagaaggaggctgggaagatatagtc
tcatctgcttcgtctgggactgagtcaagccctcagtctcccgtgacaccagatggcaaa
cggagccccaaaggcattaagaagttctggggaaagatccgaagaactcagtctggaaac
ttcaatactgatgcaccggggatggcagagtttcgacgaggtgggctccgagcaactgcg
ggaccaaggctttctaggaccagggacaccaagggacagaaatgtgatgccaatgccccc
tttgcccagtggagcacagaacgcgtatgtacatggatggaggatttcggcctgggtcag
tatgtgatctttgccagacagtgggtgacatctggacatacactactgacagctacccct
caggacatggaaaaggagctagggattaaacaccccctccacaggaagaagctggtttta
gcagtgaaagctatcaacgccaagcaagaagaaacgtctgcgctgctggaccacatttgg
gtgacacggtggcttgatgatattggcttaccccaatacaaagaccagtttcatgaatca
agagttgatgggcgaatgctgcaatacctaactgtgaatgatctactcttcttaaaagtc
accagccaactacatcatctcagcatcaaatgtgctattcacgtgctacatgtcaacaag
ttcaaccccaactgcctgcacaggaggcctgctgatgagagtaacctttccccttccgaa
gttgtgcagtggtccaaccacagggtaatggagtggctgcgatccgtggacctggcagag
tatgcacccaaccttcgagggagtggcgtccatggcggcctcattatcctggagcctcgc
tttactggggacaccctggctatgcttcttaacatccccccacagaagacgctcctcagg
cgccatctgaccaccaagttcaacgccctgattggtcctgaggctgaacaggaaaagcga
gacaaaatggcctcacccgcctacacacctctgaccaccaccgccaaagttcggcctagg
aaacttggattttcacattttggaaacatgagaaaaaagaagtttgatgaatctacagat
tacatttgccccatggagcctggagatgctgtcagtgacagccacagggtctacggagtc
taccggggcctcagtccccttgacaaccatgaactagatggtttggaccaggtgggacag
ataagctga

DBGET integrated database retrieval system