KEGG   Mus musculus (mouse): 19025Help
Entry
19025             CDS       T01002                                 

Gene name
Ctsa, AU019505, PPCA, Ppgb
Definition
(RefSeq) cathepsin A (EC:3.4.16.5)
  KO
K13289  
cathepsin A (carboxypeptidase C) [EC:3.4.16.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysosome
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    19025 (Ctsa)
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    19025 (Ctsa)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.5  carboxypeptidase C
     19025 (Ctsa)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S10
   19025 (Ctsa)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Other peptidases
   19025 (Ctsa)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   19025 (Ctsa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 H3; 2 85.27 cM
AA seq 474 aa AA seqDB search
MPGTALSPLLLLLLLSWASRNEAAPDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYW
FVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLY
IESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIP
TLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNK
CNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFT
RLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLV
NLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPW
LVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaaccgcgctgtctccactgctcttgttgctgctcctgtcctgggcgtcccgg
aacgaagcagctccggaccaggatgaaatcgattgtctccccggcctggccaagcagccc
tctttccggcaatactccggctacctcagagcatcggactccaagcacttccactactgg
tttgtggagtcgcagaacgacccaaagaacagccccgtggtgctttggcttaacgggggt
cccggctgcagctcgctcgatgggctgcttacagagcacggcccctttctgatccagcca
gatggtgtcaccctggagtacaacccctatgcttggaacctgattgccaacgtgctgtat
atcgagtccccagctggggtgggcttctcctactcggatgacaagatgtacgtgaccaat
gacacagaggtggcggagaacaattatgaagcccttaaagacttcttccgcctctttccg
gaatacaaggacaacaaacttttcctgacaggagagagctatgctggcatctacatcccc
accttggctgtactggtcatgcaggatcctagcatgaatcttcaggggctggctgtgggc
aatggacttgcctcctatgagcagaacgacaactccctggtctactttgcctactaccat
ggccttctggggaacagactttggacttcactgcagacccactgctgcgctcagaacaag
tgtaacttctatgacaacaaagacccagagtgtgtaaacaatctcctggaagtgtctcga
attgtgggcaaatctggcctcaacatctacaatctctatgctccgtgtgctggtggggtg
cccggcagacatagatatgaggacacacttgtagtccaggattttggcaacatcttcact
cgcctgccacttaagcggagatttcctgaggcactgatgcgttctggggacaaggtacgc
ttggatcctccctgcaccaacaccacagccccttccaactacctcaacaacccctatgtt
cggaaggctctccacatccccgagtcgctgccccgctgggacatgtgcaacttcttggtg
aatttacagtaccgccgcctctaccaaagcatgaactcccagtacctgaagctgctcagt
tcacagaaataccagatcctgctctacaacggagatgtggacatggcctgcaacttcatg
ggcgatgagtggtttgtggattcgctcaaccagaagatggaggtgcagcgccggccctgg
ctagtggactacggggagagcggagaacaggtagctggtttcgtgaaggagtgttcacac
atcaccttcctcaccatcaagggtgccggacacatggtccccacggacaagcctcgagct
gcttttaccatgttctcgaggttcctgaacaaagagccttactga

DBGET integrated database retrieval system