KEGG   Mus musculus (mouse): 19047Help
Entry
19047             CDS       T01002                                 

Gene name
Ppp1cc, PP-1G, PP1, dis2m1
Definition
protein phosphatase 1, catalytic subunit, gamma isoform (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    19047 (Ppp1cc)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    19047 (Ppp1cc)
   04022 cGMP - PKG signaling pathway
    19047 (Ppp1cc)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    19047 (Ppp1cc)
  Cell growth and death
   04114 Oocyte meiosis
    19047 (Ppp1cc)
  Cell communication
   04510 Focal adhesion
    19047 (Ppp1cc)
 Organismal Systems
  Immune system
   04611 Platelet activation
    19047 (Ppp1cc)
  Endocrine system
   04910 Insulin signaling pathway
    19047 (Ppp1cc)
   04921 Oxytocin signaling pathway
    19047 (Ppp1cc)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19047 (Ppp1cc)
   04270 Vascular smooth muscle contraction
    19047 (Ppp1cc)
  Nervous system
   04728 Dopaminergic synapse
    19047 (Ppp1cc)
   04720 Long-term potentiation
    19047 (Ppp1cc)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19047 (Ppp1cc)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    19047 (Ppp1cc)
  Substance dependence
   05031 Amphetamine addiction
    19047 (Ppp1cc)
   05034 Alcoholism
    19047 (Ppp1cc)
  Infectious diseases
   05168 Herpes simplex infection
    19047 (Ppp1cc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19047 (Ppp1cc)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     19047 (Ppp1cc)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     19047 (Ppp1cc)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    19047 (Ppp1cc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 F-G1
AA seq 323 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatcgacaaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagccaggcaagaatgtccagctccaggagaacgagatccgaggactctgcctg
aagtctcgggagatcttcctcagtcagcctatccttttagaacttgaagcaccactcaag
atatgtggtgacatccacgggcagtactatgatttgctccgtctgtttgaatacggtggc
tttcctccagagagcaactatttgtttctcggggactatgtggacaggggcaagcagtcc
ctggagacaatctgcctcttgctggcctacaaaatcaagtatccggagaacttctttctt
ctcagagggaaccacgagtgcgccagcatcaataggatctacggattttatgatgagtgt
aaaagaagatacaacattaagctgtggaaaacgttcacagactgttttaactgcttgccg
atagcagccatcgtggacgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgagaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggctatgagttttttgcaaag
aggcagttagtcactctgttttctgcacccaactactgtggcgagtttgacaatgcaggc
gccatgatgagtgtggatgagaccctcatgtgttccttccagattttaaagcctgcagag
aaaaagaagcccaacgccacgagacctgtcacaccaccacggggtatgatcacaaagcaa
gcaaagaaatag

DBGET integrated database retrieval system