KEGG   Mus musculus (mouse): 19058Help
Entry
19058             CDS       T01002                                 

Gene name
Ppp3r1, CaNB1, Cnb1, MCIP1
Definition
(RefSeq) protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I)
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu05010  Alzheimer's disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    19058 (Ppp3r1)
   04310 Wnt signaling pathway
    19058 (Ppp3r1)
   04370 VEGF signaling pathway
    19058 (Ppp3r1)
   04020 Calcium signaling pathway
    19058 (Ppp3r1)
   04022 cGMP - PKG signaling pathway
    19058 (Ppp3r1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    19058 (Ppp3r1)
   04218 Cellular senescence
    19058 (Ppp3r1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    19058 (Ppp3r1)
   04650 Natural killer cell mediated cytotoxicity
    19058 (Ppp3r1)
   04660 T cell receptor signaling pathway
    19058 (Ppp3r1)
   04658 Th1 and Th2 cell differentiation
    19058 (Ppp3r1)
   04659 Th17 cell differentiation
    19058 (Ppp3r1)
   04662 B cell receptor signaling pathway
    19058 (Ppp3r1)
  Endocrine system
   04922 Glucagon signaling pathway
    19058 (Ppp3r1)
   04921 Oxytocin signaling pathway
    19058 (Ppp3r1)
   04924 Renin secretion
    19058 (Ppp3r1)
  Nervous system
   04724 Glutamatergic synapse
    19058 (Ppp3r1)
   04720 Long-term potentiation
    19058 (Ppp3r1)
  Development
   04360 Axon guidance
    19058 (Ppp3r1)
   04380 Osteoclast differentiation
    19058 (Ppp3r1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    19058 (Ppp3r1)
   05014 Amyotrophic lateral sclerosis (ALS)
    19058 (Ppp3r1)
  Substance dependence
   05031 Amphetamine addiction
    19058 (Ppp3r1)
  Infectious diseases
   05152 Tuberculosis
    19058 (Ppp3r1)
   05166 HTLV-I infection
    19058 (Ppp3r1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    19058 (Ppp3r1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     19058 (Ppp3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 19058
NCBI-ProteinID: NP_077779
MGI: 107172
Ensembl: ENSMUSG00000033953
Vega: OTTMUSG00000005195
UniProt: Q63810
Structure
PDB: 

Jmol
Position
11; 11 A2
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcgagttaccctttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctaggaaagagattcaagaagcttgatttggacaattctggttctttgagcgtg
gaagagttcatgtctctgcctgagttacagcagaaccctttagtacagcgggtaatagat
atattcgacacagacggcaacggagaagtggacttcaaagaattcattgaaggagtgtct
cagttcagtgtcaaaggcgataaggaacagaagttgaggtttgcttttcgtatctatgac
atggataaagatggctatatttccaatggagaactcttccaggtgttgaagatgatggtg
ggcaacaatctgaaagatacacaattacagcagattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaggaattctgtgctgtcgtaggtggccta
gatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system